FCRL3/FcRH3 Antibody Summary
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of Human FCRL3/FcRH3. Peptide sequence RGSSLSDAVHVEFSPDWLILQALHPVFEGDNVILRCQGKDNKNTHQKVYY |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
FCRL3 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Theoretical MW |
21 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for FCRL3/FcRH3 Antibody
Background
The FCRL3 gene codes for a member of the immunoglobulin receptor superfamily, a Fc receptor-like protein 3 that has seven isoforms: isoform 1: 734 amino acids long, 80 kDA; isoform 2: 639 amino acids long, nearly 70 kDA; isoform 3: 740 amino acids long, 81 kDA; isoform 4: 189 amino acids long, 21 kDA; isoform 5: 199 amino acids long, 22 kDA; isoform 6: 742 amino acid long, 81 kDA; and isoform 7: 707 amino acids long, 77 kDA. This protein functions in the moderation of the immune system as it obtains immunoreceptor-tyrosine activation motifs as well as immunoreceptor-tyrosine inhibitory motifs in its cytoplasmic domain. It is known to interact with genes SYK, PTPN6, ZAP70, and PTPN11. FCRL3 is linked to multiple sclerosis, graves' disease, arthritis, lupus, rheumatoid arthritis, alopecia areata, behcet's disease, and primary biliary cirrhosis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Mu
Applications: CyTOF-ready, Flow
Species: Mu
Applications: CyTOF-ready, Flow, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu, Pm, Mu(-)
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Pm, Ca, Pm, Hu, Pm, Sq
Applications: Flow, ICC/IF
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Bv, Hu, Mu, Rt
Applications: Dual ISH-IHC, Flow, IB, ICC/IF, IHC, IHC-P, IP, Single-Cell Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA, WB
Species: Hu
Applications: WB
Publications for FCRL3/FcRH3 Antibody (NBP3-09272) (0)
There are no publications for FCRL3/FcRH3 Antibody (NBP3-09272).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for FCRL3/FcRH3 Antibody (NBP3-09272) (0)
There are no reviews for FCRL3/FcRH3 Antibody (NBP3-09272).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for FCRL3/FcRH3 Antibody (NBP3-09272) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional FCRL3/FcRH3 Products
Blogs on FCRL3/FcRH3