Home » FAIM1 » FAIM1 Antibodies » FAIM1 Antibody
Novus Biologicals products are now on bio-techne.com

FAIM1 Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: FAIM1 Antibody [NBP2-48764] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.
Immunocytochemistry/ Immunofluorescence: FAIM1 Antibody [NBP2-48764] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: FAIM1 Antibody [NBP2-48764] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

FAIM1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MLLPFIRTLPLLCYNHLLVSPDSATLSPPYSLEKMTDLVAVWDVALSDGVHKIEFEHGTTSGKRVVYVDGK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAIM
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FAIM1 Recombinant Protein Antigen (NBP2-48764PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FAIM1 Antibody

  • FAIM1FLJ10582
  • fas apoptotic inhibitory molecule 1
  • Fas apoptotic inhibitory molecule

Background

FAIM1 (or Fas Apoptotic Inhibitory Molecule 1) is a recently discovered negative regulator of apoptosis. FAIM1 has no significant regions of homology to other gene products that modulate Fas killing. It plays a role as an inducible effector molecule that mediates Fas resistance produced by surface Ig engagement in B cells. Overexpression of FAIM1 diminishes sensitivity to Fas-mediated apoptosis of B and non-B cell lines. FAIM1 is highly evolutionarily conserved and is widely expressed in murine tissues, suggesting that FAIM1 plays an important role in cellular physiology.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

FLIP Antibody
[Unconjugated]
AF821
Western Blot FLIP Antibody [Unconjugated]
Western Blot FLIP Antibody [Unconjugated]
Western Blot FLIP Antibody [Unconjugated]
(11 Publications)
Species: Hu, Mu
Applications: WB
Fas/TNFRSF6/CD95
Antibody - BSA Free
NB120-13550
Immunocytochemistry/ Immunofluorescence Fas/TNFRSF6/CD95 Antibody - BSA Free
Western Blot Fas/TNFRSF6/CD95 Antibody - BSA Free
Immunohistochemistry-Paraffin Fas/TNFRSF6/CD95 Antibody - BSA Free
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Caspase-8 Antibody
NB100-56116
Western Blot Caspase-8 Antibody
Immunohistochemistry-Paraffin Caspase-8 Antibody
Immunohistochemistry-Paraffin Caspase-8 Antibody
(2 Reviews)
(79 Publications)
Species: Ma, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Bcl-xL Antibody
NB100-56104
Western Blot Bcl-xL Antibody
Immunohistochemistry-Paraffin Bcl-xL Antibody
Western Blot Bcl-xL Antibody
(1 Review)
(3 Publications)
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(818 Publications)
Species: Hu
Applications: BA
IRF4 Antibody
AF5525
Immunohistochemistry IRF4 Antibody
Western Blot IRF4 Antibody
(1 Review)
(1 Publication)
Species: Hu
Applications: IHC, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(42 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Caspase-3 Antibody
[Unconjugated] - Acti ...
AF835
Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active
Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active
Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active
(7 Reviews)
(389 Publications)
Species: Hu, Mu
Applications: ICC, IHC
XIAP Antibody
[Unconjugated]
AF8221
Western Blot XIAP Antibody [Unconjugated]
Simple Western XIAP Antibody [Unconjugated]
Knockout Validated XIAP Antibody [Unconjugated]
(24 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
Fas Ligand/TNFSF6
[Unconjugated]
126-FL/CF
Fas Ligand/TNFSF6 [Unconjugated]
(20 Publications)
Species: Hu
Applications: BA
Caspase-9 Antibody
NB100-56118
Immunohistochemistry Caspase-9 Antibody
Immunohistochemistry Caspase-9 Antibody
Immunohistochemistry Caspase-9 Antibody
(1 Review)
(28 Publications)
Species: Ca, Ma, Hu, Mu, Rt
Applications: Flow-IC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
CXCL9/MIG Antibody
[Unconjugated]
AF-492-NA
Neutralization CXCL9/MIG Antibody [Unconjugated]
Immunocytochemistry/ Immunofluorescence CXCL9/MIG Antibody [Unconjugated]
Western Blot CXCL9/MIG Antibody [Unconjugated]
(31 Publications)
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Neut
FADD [p Ser194]
Antibody (709736)
MAB7047
Western Blot FADD [p Ser194] Antibody (709736)
Immunocytochemistry FADD [p Ser194] Antibody (709736)
Species: Hu
Applications: ICC, WB
BID Antibody
[Unconjugated]
AF860
Simple Western BID Antibody [Unconjugated]
Western Blot BID Antibody [Unconjugated]
Western Blot BID Antibody [Unconjugated]
(1 Review)
(39 Publications)
Species: Hu, Mu
Applications: IP, Simple Western, WB
PDCD6 Antibody
(722232)
MAB6015
Western Blot PDCD6 Antibody (722232)
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB
APAF-1 Antibody
(94408)
MAB868
Western Blot APAF-1 Antibody (94408)
(8 Publications)
Species: Hu
Applications: WB
NFkB p105/p50
Antibody (2J10D7) - B ...
NB100-56583
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
(1 Review)
(5 Publications)
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
Bax Antibody (6A7)
NBP1-28566
Western Blot Bax Antibody (6A7)
Western Blot Bax Antibody (6A7)
Immunohistochemistry-Frozen Bax Antibody (6A7)
(3 Reviews)
(21 Publications)
Species: Bv, Hu, Pm, Mu, Po, Rt
Applications: Func, IHC, IHC-Fr, IHC-P, WB

Publications for FAIM1 Antibody (NBP2-48764) (0)

There are no publications for FAIM1 Antibody (NBP2-48764).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAIM1 Antibody (NBP2-48764) (0)

There are no reviews for FAIM1 Antibody (NBP2-48764). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FAIM1 Antibody (NBP2-48764) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FAIM1 Products

Research Areas for FAIM1 Antibody (NBP2-48764)

Find related products by research area.

Blogs on FAIM1

There are no specific blogs for FAIM1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAIM1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol FAIM