Factor V Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: MPSPSSPTLNDTFLSKEFNPLVIVGLSKDGTDYIEIIPKEEVQSSEDDYAEIDYVPYDDPYKTDVRTNINSSRDPDNIAAWYLRSNNGNRRNYYIAAEEISWDYSEFVQRETDIEDSDDIPEDTT |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
F5 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
Application Notes |
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for Factor V Antibody
Background
The F5 gene encodes a 2,224 amino acid long, 251 kDA coagulation factor V protein that is critical in the regulation of homeostasis. Additionally, F5 functions as a cofactor for the prothrombinase activity of factor Xa which results in the initiation of prothrombin to thrombin. F5 participates in blood coagulation signaling pathways, the blood clotting cascade, platelet degranulation as well as activation, signaling, and aggregation, and in responses to elevated platelet cytosolic Ca2+. It interacts with genes PROC, PROS1, F2, MMRN1, and CALR. Defects in F5 cause factor 5 deficiency (owren parahemophilia), thrombophilia due to activated protein C resistance, susceptibility to Budd-Chiari syndrome, susceptibility to ischemic strokes, and susceptibility to pregnancy loss, recurrent, type 1. F5 is also linked to deep vein thrombosis, antithrombin III deficiency, retinal vein occlusion, legg-calve-perthes disease, liver disease, hypertension, pulmonary embolism, lupus, and patent foramen ovale.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Mu
Applications: IP, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IP, Neut, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, Neut, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Rt
Applications: ELISA, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
Species: Hu
Applications: ICC, IP, WB
Species: Hu
Applications: ICC/IF
Publications for Factor V Antibody (NBP1-88114) (0)
There are no publications for Factor V Antibody (NBP1-88114).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Factor V Antibody (NBP1-88114) (0)
There are no reviews for Factor V Antibody (NBP1-88114).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Factor V Antibody (NBP1-88114) (0)