![Western Blot: EXOC7 Antibody (1D4) [H00023265-M01] - EXOC7 monoclonal antibody (M01), clone 1D4 Analysis of EXOC7 expression in HeLa.](http://images.novusbio.com/fullsize/EXOC7-Antibody-1D4-Western-Blot-H00023265-M01-img0007.jpg "Western Blot: EXOC7 Antibody (1D4) [H00023265-M01] - EXOC7 monoclonal antibody (M01), clone 1D4 Analysis of EXOC7 expression in HeLa.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, IHC |
| Clone | 1D4 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | EXOC7 (NP_001013861, 586 a.a. ~ 684 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VFQPGVKLRDKERQIIKERFKGFNDGLEELCKIQKAWAIPDTEQRDRIRQAQKTIVKETYGAFLQKFGSVPFTKNPEKYIKYGVEQVGDMIDRLFDTSA |
| Specificity | EXOC7 - exocyst complex component 7 |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | EXOC7 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | EXOC7 |
| Entrez |
|
| OMIM |
|
| Uniprot |
|
![Immunohistochemistry-Paraffin: EXOC7 Antibody (1D4) [H00023265-M01] - Analysis of monoclonal antibody to EXOC7 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml.](http://images.novusbio.com/fullsize/EXOC7-Antibody-1D4-Immunohistochemistry-Paraffin-H00023265-M01-img0005.jpg "Immunohistochemistry-Paraffin: EXOC7 Antibody (1D4) [H00023265-M01] - Analysis of monoclonal antibody to EXOC7 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml.")
![Sandwich ELISA: EXOC7 Antibody (1D4) [H00023265-M01] - Detection limit for recombinant GST tagged EXOC7 is approximately 1ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/EXOC7-Antibody-1D4-Sandwich-ELISA-H00023265-M01-img0006.jpg "Sandwich ELISA: EXOC7 Antibody (1D4) [H00023265-M01] - Detection limit for recombinant GST tagged EXOC7 is approximately 1ng/ml as a capture antibody.")
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![SDS-PAGE EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236-EG_234.jpg)
![Bioactivity EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236EG_1570.jpg)
![Cell Culture EGF [Unconjugated]](https://images.novusbio.com/images/236-eg_recombinant-human-egf-protein-cf-bioactivity-25202394053.jpg)
![Western Blot Angiopoietin-like Protein 2/ANGPTL2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Angiopoietinlike_Protein_2_AF1444_Western_Blot_19840.jpg)
