![Immunohistochemistry-Paraffin: espin Antibody [NBP1-90588] - Staining in human testis and skeletal muscle tissues using NBP1-90588 antibody. Corresponding ESPN RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/espin-Antibody-Immunohistochemistry-Paraffin-NBP1-90588-img0020.jpg "Immunohistochemistry-Paraffin: espin Antibody [NBP1-90588] - Staining in human testis and skeletal muscle tissues using NBP1-90588 antibody. Corresponding ESPN RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, RtSpecies Glossary |
| Applications | WB, Simple Western, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SMPAWRRDLLRKKLEEEREQKRKEEERQKQEELRREKEQSEKLRTLGYDESKLAPWQRQVILKK |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ESPN |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry PTH Antibody (918462) [Unconjugated]](https://images.novusbio.com/images2/PTH_MAB7665_Immunohistochemistry_16650.jpg)
![Western Blot PTH Antibody (918462) [Unconjugated]](https://images.novusbio.com/images2/PTH_MAB7665_Western_Blot_16656.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for espin Antibody (NBP1-90588)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: espin Antibody [NBP1-90588] - Analysis in human cell line SK-BR-3.](http://images.novusbio.com/fullsize/espin-Antibody-Western-Blot-NBP1-90588-img0011.jpg "Western Blot: espin Antibody [NBP1-90588] - Analysis in human cell line SK-BR-3.")
![Immunohistochemistry-Paraffin: espin Antibody [NBP1-90588] - Staining of human duodenum shows strong positivity in apical membrane in glandular cells.](http://images.novusbio.com/fullsize/espin-Antibody-Immunohistochemistry-Paraffin-NBP1-90588-img0016.jpg "Immunohistochemistry-Paraffin: espin Antibody [NBP1-90588] - Staining of human duodenum shows strong positivity in apical membrane in glandular cells.")
![Immunohistochemistry-Paraffin: espin Antibody [NBP1-90588] - Staining of human kidney shows strong positivity in luminal membrane in cells in tubules.](http://images.novusbio.com/fullsize/espin-Antibody-Immunohistochemistry-Paraffin-NBP1-90588-img0017.jpg "Immunohistochemistry-Paraffin: espin Antibody [NBP1-90588] - Staining of human kidney shows strong positivity in luminal membrane in cells in tubules.")
![Immunohistochemistry-Paraffin: espin Antibody [NBP1-90588] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/espin-Antibody-Immunohistochemistry-Paraffin-NBP1-90588-img0018.jpg "Immunohistochemistry-Paraffin: espin Antibody [NBP1-90588] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: espin Antibody [NBP1-90588] - Staining of human testis shows moderate membranous positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/espin-Antibody-Immunohistochemistry-Paraffin-NBP1-90588-img0019.jpg "Immunohistochemistry-Paraffin: espin Antibody [NBP1-90588] - Staining of human testis shows moderate membranous positivity in cells in seminiferous ducts.")
![Simple Western: espin Antibody [NBP1-90588] - Simple Western lane view shows a specific band for ESPN in 0.2 mg/ml of RT-4 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://images.novusbio.com/fullsize/espin-Antibody-Simple-Western-NBP1-90588-img0008.jpg "Simple Western: espin Antibody [NBP1-90588] - Simple Western lane view shows a specific band for ESPN in 0.2 mg/ml of RT-4 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.")
![Simple Western: espin Antibody [NBP1-90588] - Electropherogram image(s) of corresponding Simple Western lane view. espin antibody was used at 1:20 dilution on RT-4 lysate(s).](http://images.novusbio.com/fullsize/espin-Antibody-Simple-Western-NBP1-90588-img0009.jpg "Simple Western: espin Antibody [NBP1-90588] - Electropherogram image(s) of corresponding Simple Western lane view. espin antibody was used at 1:20 dilution on RT-4 lysate(s).")
![Simple Western Vinculin Antibody (728526) [Unconjugated]](https://images.novusbio.com/images2/Vinculin_MAB6896_Simple_Western_16408.jpg)
![Western Blot Vinculin Antibody (728526) [Unconjugated]](https://images.novusbio.com/images2/Vinculin_MAB6896_Western_Blot_11566.jpg)
![Immunohistochemistry Vinculin Antibody (728526) [Unconjugated]](https://images.novusbio.com/images2/Vinculin_MAB6896_Immunohistochemistry_11621.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")