Novus Biologicals products are now on bio-techne.com

ERP44 Recombinant Protein Antigen

Name: ERP44 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-89617PEP
Price: 279 USD

Images

There are currently no images for ERP44 Protein (NBP1-89617PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

ERP44 Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ERP44. Source: E. coli Amino Acid Sequence: VFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKSDPIQEIRDLAEITTLDRSKRNIIGYFEQKDSDNYRVFERVANILHDDCAFLSAFGDVSKPERYSGDNIIYKPPGHSAPD Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	ERP44
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89617. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	33 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ERP44 Recombinant Protein Antigen

endoplasmic reticulum protein 44
endoplasmic reticulum resident protein 44 kDa
ER protein 44
ERp44
KIAA0573endoplasmic reticulum resident protein 44
PDIA10
protein disulfide isomerase family A, member 10
thioredoxin domain containing 4 (endoplasmic reticulum)
Thioredoxin domain-containing protein 4
TXNDC4

Background

ERP44 mediates thiol-dependent retention in the early secretory pathway, forming mixed disulfides with substrate proteins through its conserved CRFS motif. Inhibits the calcium channel activity of ITPR1. May have a role in the control of oxidative protei

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Adiponectin/Acrp30
[HRP]

DRP300

(186 Publications)

Species: Hu

Applications: ELISA

PPAR gamma/NR1C3
Antibody - BSA Free

NBP2-22106

Immunohistochemistry-Paraffin PPAR gamma/NR1C3 Antibody - BSA Free

(2 Reviews)

(11 Publications)

Species: Hu, Mu, Rt

Applications: IHC, IHC-P, IP, WB

IP3R1 Antibody

NBP1-21398

(1 Review)

(2 Publications)

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P, IP, WB

PADI1 Antibody

NBP2-37761

Species: Hu

Applications: ICC/IF, IHC, IHC-P

ERO1L Antibody

NB100-2525

Immunocytochemistry/ Immunofluorescence ERO1L Antibody

(1 Review)

(14 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, WB

Protein Disulfide
Isomerase/P4HB Antibo ...

NB300-517

Immunocytochemistry/ Immunofluorescence Protein Disulfide Isomerase/P4HB Antibody (RL90)

(3 Reviews)

(28 Publications)

Species: Bv, Ha, Hu, Pm, Mu, Po, Pm, Rb, Rt

Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP, KD, WB

PDIA2 Antibody

NBP2-49086

Species: Hu

Applications: ICC/IF, IHC, IHC-P

IP3R3 Antibody

NBP1-21399

(1 Publication)

Species: Hu

Applications: IHC, IHC-P, IP, WB (-)

TXNDC15 Antibody

NBP1-89394

Immunohistochemistry-Paraffin TXNDC15 Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P

LMAN1 Antibody
(OTI1A8)

NBP2-03381

(4 Publications)

Species: Ca, Hu, Pm, Mu, Pm, Rt

Applications: Flow, ICC/IF, IHC, IHC-P, WB

Insulin Antibody
(182410) [Unconjugate ...

MAB1417

Immunohistochemistry Insulin Antibody (182410) [Unconjugated]

(24 Publications)

Species: Bv, Hu, Mu

Applications: CyTOF-ready, ICC, IHC, ICFlow

ITPR2 Antibody

NB100-2466

Immunohistochemistry-Paraffin ITPR2 Antibody

(1 Review)

(7 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB

AHCYL1 Antibody

NBP1-83093

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, KD, WB

Sulfatase
Modifying Factor 1/SU ...

AF3680

(1 Publication)

Species: Hu

Applications: WB

Calreticulin
Antibody - BSA Free

NB600-101

Western Blot Calreticulin Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence Calreticulin Antibody - BSA Free

(28 Publications)

Species: Bv, Ha, Hu, Mu, Pm, Rt

Applications: B/N, DB, EM, Flow, ICC/IF, IHC, IHC-P, IP, KD, PA, Simple Western, WB

COX-2 Antibody

NB100-689

(1 Review)

(36 Publications)

Species: Hu, Rt

Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB

SLC6A4/5-HTTLPR/Seroto ...

H00006532-D01P

Western Blot SLC6A4/5-HTTLPR/Serotonin transporter Antibody

(1 Review)

(1 Publication)

Species: Hu, Mu

Applications: WB

gamma Sarcoglycan
Antibody

NBP1-90299

Immunocytochemistry/ Immunofluorescence gamma Sarcoglycan Antibody

(1 Review)

Species: Hu

Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB

CD1b Antibody
(737249) [Unconjugate

MAB7446

(1 Publication)

Species: Hu

Applications: CyTOF-ready, Flow

CDCA7L Antibody
(OTI3B5)

NBP2-46198

Immunohistochemistry CDCA7L Antibody (OTI3B5)

(1 Review)

(1 Publication)

Species: Hu

Applications: IHC, IHC-P, WB

Publications for ERP44 Protein (NBP1-89617PEP) (0)

There are no publications for ERP44 Protein (NBP1-89617PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ERP44 Protein (NBP1-89617PEP) (0)

There are no reviews for ERP44 Protein (NBP1-89617PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ERP44 Protein (NBP1-89617PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ERP44 Products

Blogs on ERP44

There are no specific blogs for ERP44, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our ERP44 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

ERP44

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

ERP44 Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

ERP44 Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for ERP44 Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for ERP44 Protein (NBP1-89617PEP) (0)

Reviews for ERP44 Protein (NBP1-89617PEP) (0)

FAQs for ERP44 Protein (NBP1-89617PEP) (0)

Additional ERP44 Products

Blogs on ERP44

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics