ELSPBP1 Antibody Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to the amino acids: TTENMDKDGKWSFCADTRISALVPGFPCHFPFNYKNKNYFNCTNKGSKENLVWCATSYNYDQDHTWVYC |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
ELSPBP1 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:20-1:50
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for ELSPBP1 Antibody
Background
The protein encoded by the ELSPBP1 gene belongs to the sperm-coating protein family of epididymal origin. This protein and itscanine homolog are the first known examples of proteins with four tandemly arranged fibronectin type 2 (Fn2) domainsin the Fn2-module protein family. (provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: CyTOF-ready, Flow-CS, Flow, IHC, IHC-P
Species: Hu
Applications: ICC, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, WB
Species: Hu
Applications: ICC, WB
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Mu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: ICC, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA, BA
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC
Publications for ELSPBP1 Antibody (NBP2-13958) (0)
There are no publications for ELSPBP1 Antibody (NBP2-13958).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ELSPBP1 Antibody (NBP2-13958) (0)
There are no reviews for ELSPBP1 Antibody (NBP2-13958).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for ELSPBP1 Antibody (NBP2-13958) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ELSPBP1 Products
Research Areas for ELSPBP1 Antibody (NBP2-13958)
Find related products by research area.
|
Blogs on ELSPBP1