Novus Biologicals products are now on bio-techne.com

Recombinant Human ELKS GST (N-Term) Protein

Name: Recombinant Human ELKS GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00023085-P01
Price: 589 USD

Submit a Review

Images

(

Enlarge)

12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	WB, ELISA, MA, AP

Order Details

Novus Biologicals offers 100% Guarantee

Recombinant Human ELKS GST (N-Term) Protein Summary

Description	Recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-91 of Human ERC1 Source: Wheat Germ (in vitro) Amino Acid Sequence: MPKQVVWHGHWPAALSKQVAQIPPTWTFSSGAAPATLSHWVCDSPLHLSILHHFPSRKTDGRKPSVTLLLRRSISGTDIICLVSVNSKESS
Preparation Method	in vitro wheat germ expression system
Details of Functionality	This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source	Wheat germ
Protein/Peptide Type	Recombinant Protein
Gene	ERC1
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	ELISA Immunoaffinity Purification Protein Array Western Blot
Theoretical MW	36.4 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -80C. Avoid freeze-thaw cycles.
Buffer	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ELKS GST (N-Term) Protein

ELKS/RAB6-interacting/CAST family member 1
ELKSCAST2
ERC-1
FLJ31750
KIAA1081Cast2
MGC12974
RAB6 interacting protein 2
Rab6-interacting protein 2
RAB6IP2

Background

The protein encoded by this gene is a member of a family of RIM-binding proteins. RIMs are active zone proteins that regulate neurotransmitter release. This gene has been found fused to the receptor-type tyrosine kinase gene RET by gene rearrangement due to the translocation t(10;12)(q11;p13). Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

RIMS1 Antibody

NBP3-30337

Species: Hu, Mu

Applications: WB

PAF49 Antibody -
BSA Free

NBP2-19676

Immunohistochemistry-Paraffin PAF49 Antibody - BSA Free

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

Calpastatin
Antibody (OTI1E7)

NBP2-01819

Western Blot Calpastatin Antibody (OTI1E7)

Immunohistochemistry-Paraffin Calpastatin Antibody (OTI1E7)

Species: Hu

Applications: Flow, IHC, IHC-P, WB

CtIP Antibody -
BSA Free

NB100-79810

Immunoprecipitation CtIP Antibody - BSA Free

(5 Publications)

Species: Hu, Mu

Applications: ICC/IF, IP, WB

Bassoon Antibody
(SAP7F407) - BSA Free

NB120-13249

Immunohistochemistry Bassoon Antibody (SAP7F407) - BSA Free

Immunocytochemistry/ Immunofluorescence Bassoon Antibody (SAP7F407) - BSA Free

(1 Review)

(15 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

IKK gamma
Inhibitor Peptide Set

NBP2-26504

(22 Publications)

Species: Hu, Mu, Rt

Applications: B/N, Func-Inh, In vitro, In vivo

ERC2 Antibody -
BSA Free

NBP2-62683

Species: Hu

Applications: IHC, IHC-P

RAB6A Antibody -
BSA Free

NBP1-33110

(1 Publication)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, KO, WB

ATM Antibody (2C1)
- Azide and BSA Free

NB100-309

Immunoprecipitation ATM Antibody (2C1) - Azide and BSA Free

(3 Reviews)

(131 Publications)

Species: Hu, Pm, Mu, Rt

Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, PAGE, Single-Cell Western, WB

Ret Antibody
[Unconjugated]

AF482

Western Blot Ret Antibody [Unconjugated]

(40 Publications)

Species: Mu

Applications: IHC, WB

Piccolo Antibody -
BSA Free

NBP1-90250

(2 Publications)

Species: Hu

Applications: ICC/IF, IHC, IHC-P

XIAP Antibody
[Unconjugated]

AF8221

Simple Western XIAP Antibody [Unconjugated]

Knockout Validated XIAP Antibody [Unconjugated]

(25 Publications)

Species: Hu, Mu, Rt

Applications: IHC, KO, Simple Western, WB

NFkB p105/p50
Antibody (2J10D7) - B ...

NB100-56583

(1 Review)

(5 Publications)

Species: Hu, Rb, Rt

Applications: Flow, IHC, IHC-P, KO, Simple Western, WB

TNF-alpha
[Unconjugated]

210-TA

(3 Reviews)

(822 Publications)

Species: Hu

Applications: BA

Bassoon Antibody
(SAP7F407) - BSA Free

NB120-13249

(1 Review)

(15 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

IKK beta Antibody
(10AG2) - BSA Free

NB100-56509

Immunocytochemistry/ Immunofluorescence IKK beta Antibody (10AG2) - BSA Free

(2 Reviews)

(60 Publications)

Species: Hu, Mu, Rt

Applications: CyTOF-ready, Flow, IB, ICC/IF, IHC, IHC-P, IP, Simple Western, WB

CXCL8/IL-8
Antibody (6217) [Unco ...

MAB208

Immunocytochemistry CXCL8/IL-8 Antibody (6217) [Unconjugated]

Western Blot CXCL8/IL-8 Antibody (6217) [Unconjugated]

(1 Review)

(184 Publications)

Species: Hu

Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB

UBE2N/Ubc13
Antibody (10O9Z5)

NBP3-16793

Immunocytochemistry/ Immunofluorescence UBE2N/Ubc13 Antibody (10O9Z5)

Western Blot UBE2N/Ubc13 Antibody (10O9Z5)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

Publications for ELKS Recombinant Protein (H00023085-P01) (0)

There are no publications for ELKS Recombinant Protein (H00023085-P01).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ELKS Recombinant Protein (H00023085-P01) (0)

There are no reviews for ELKS Recombinant Protein (H00023085-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ELKS Recombinant Protein (H00023085-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ELKS Products

Blogs on ELKS

There are no specific blogs for ELKS, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.

TNF-alpha [Unconjugated]
210-TA-005

Recombinant Human IL-8/CXCL8 (Catalog # 208-IL) chemoattracts the BaF3 mouse pro‑B cell line transfected with human CXCR2 in a dose-dependent manner (orange line). The amount of cells that migrated through to the lower chemotaxis chamber was measured by Resazurin (Catalog # AR002). Chemotaxis elicited by Recombinant Human IL-8/CXCL8 (20 ng/mL) is neutralized (green line) by increasing concentrations of Mouse Anti-Human IL-8/CXCL8 Monoclonal Antibody (Catalog # MAB208). The ND50 is typically0.08-0.4 µg/mL.

CXCL8/IL-8 Antibody (6217) [Unconjugated]
MAB208-100

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Review this Product

Be the first to review our Recombinant Human ELKS GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol

ERC1

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Recombinant Human ELKS GST (N-Term) Protein

Species Glossary

Images

Product Details

Order Details

Recombinant Human ELKS GST (N-Term) Protein Summary

Applications/Dilutions

Packaging, Storage & Formulations

Notes

Alternate Names for Recombinant Human ELKS GST (N-Term) Protein

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for ELKS Recombinant Protein (H00023085-P01) (0)

Reviews for ELKS Recombinant Protein (H00023085-P01) (0)

Product General Protocols

Video Protocols

FAQs for ELKS Recombinant Protein (H00023085-P01) (0)

Additional ELKS Products

Blogs on ELKS

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics