ELF3/ESE-1 Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: ATCEISNIFSNYFSAMYSSEDSTLASVPPAATFGADDLVLTLSNPQMSLEGTEKASWLGEQPQFWSKTQVLDWISYQVEKNKYDASAIDFSRCDMDGATLCNCALEELRLVFGPLGDQLHAQLRDLTSSSSDELSWIIELLEKDGMA |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
ELF3 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
- Western Blot 0.04-0.4 ug/ml
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Theoretical MW |
41 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Control Peptide |
|
Reactivity Notes
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for ELF3/ESE-1 Antibody
Background
ESE-1 (Epithelium-Specific Ets) is a novel, highly tissue-restricted member of the ets transcription factor/oncogene family, which has features distinct from those of any other ets-related factor. ESE-1 binds with high affinity to and transactivates the ets binding site in the promoter of the keratinocyte terminal differentiation marker gene, SPRR2A. ESE-1 is a critical regulator of epithelial cell differentiation.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: EnzAct
Species: Hu
Applications: ICC, KO, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: BA
Species: Ca, Hu, Mu, Po, Pm, Rt(-)
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, PLA, WB
Species: Hu
Applications: WB, IHC
Publications for ELF3/ESE-1 Antibody (NBP1-87945) (0)
There are no publications for ELF3/ESE-1 Antibody (NBP1-87945).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ELF3/ESE-1 Antibody (NBP1-87945) (0)
There are no reviews for ELF3/ESE-1 Antibody (NBP1-87945).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ELF3/ESE-1 Antibody (NBP1-87945). (Showing 1 - 1 of 1 FAQ).
-
Do you have any data to indicate that it works for ChIP, and if not are you willing to provide 8 ug for a trial ChIP - we will give shipping charges.
- We have not tested this antibody for its use in ChIP. While we can not provide you a trial sample, if you would like to test this antibody in an untested application and share your results with us, then I can recommend our Innovators Reward Program.
Secondary Antibodies
| |
Isotype Controls
|
Additional ELF3/ESE-1 Products
Research Areas for ELF3/ESE-1 Antibody (NBP1-87945)
Find related products by research area.
|
Blogs on ELF3/ESE-1