Home » EIF2 beta » EIF2 beta Antibodies » EIF2 beta Antibody
Novus Biologicals products are now on bio-techne.com

EIF2 beta Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: EIF2 beta Antibody [NBP2-38483] - Staining of human cell line CACO-2 shows positivity in nucleoli and cytoplasm.
Immunocytochemistry/ Immunofluorescence: EIF2 beta Antibody [NBP2-38483] - Staining of human cell line CACO-2 shows positivity in nucleoli and cytoplasm.
Immunohistochemistry: EIF2 beta Antibody [NBP2-38483] - Staining of human oral mucosa shows strong cytoplasmic positivity in squamous epithelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

EIF2 beta Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: DEALEDEDNKKDDGISFSNQTGPAWAGSERDYTYEELLNRVFNIMREKNPDMVAGEKRKFVMKPPQVVRVGTKK
Predicted Species
Mouse (95%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EIF2S2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
EIF2 beta Protein (NBP2-38483PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EIF2 beta Antibody

  • DKFZp686L18198
  • EIF2
  • EIF2B
  • EIF2beta
  • eIF-2-beta
  • eukaryotic initiation factor 2-beta
  • eukaryotic translation initiation factor 2 beta
  • eukaryotic translation initiation factor 2 subunit 2
  • Eukaryotic translation initiation factor 2 subunit beta
  • eukaryotic translation initiation factor 2, subunit 2 (beta, 38kD )
  • eukaryotic translation initiation factor 2, subunit 2 beta, 38kDa
  • MGC8508

Background

Eukaryotic translation initiation factor 2 (EIF-2) functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA and binding to a 40S ribosomal subunit. EIF-2 is composed of three subunits, alpha, beta, and gamma, with the protein encoded by this gene representing the beta subunit. The beta subunit catalyzes the exchange of GDP for GTP, which recycles the EIF-2 complex for another round of initiation. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

eIF2B epsilon
Antibody (5M2D4)
NBP3-16674
Western Blot eIF2B epsilon Antibody (5M2D4)
Immunocytochemistry/ Immunofluorescence eIF2B epsilon Antibody (5M2D4)
Immunohistochemistry-Paraffin eIF2B epsilon Antibody (5M2D4)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
eIF4E [p Ser209]
Antibody
NB100-81898
Western Blot eIF4E [p Ser209] Antibody
Immunocytochemistry/ Immunofluorescence eIF4E [p Ser209] Antibody
Immunohistochemistry-Paraffin eIF4E [p Ser209] Antibody
(1 Publication)
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, WB
4EBP1 Antibody
NB200-157
Knockout Validated 4EBP1 Antibody
Western Blot 4EBP1 Antibody
Western Blot 4EBP1 Antibody
(45 Publications)
Species: Hu
Applications: IHC, IHC-P, KO, WB
eIF4G1 Antibody
NB100-268
Western Blot eIF4G1 Antibody
Immunoprecipitation eIF4G1 Antibody
(26 Publications)
Species: Hu, Po
Applications: IP, WB
Ribosomal Protein
S6/RPS6 Antibody
NB100-1595
Immunohistochemistry-Paraffin Ribosomal Protein S6/RPS6 Antibody
Western Blot Ribosomal Protein S6/RPS6 Antibody
Immunoprecipitation Ribosomal Protein S6/RPS6 Antibody
(1 Review)
(6 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
SOS2 Antibody
[Unconjugated]
AF6260
Western Blot SOS2 Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: WB
SOS1 Antibody
(SOS-01) - BSA Free
NB110-68800
Western Blot SOS1 Antibody (SOS-01) - BSA Free
Immunocytochemistry/ Immunofluorescence SOS1 Antibody (SOS-01) - BSA Free
Immunocytochemistry/ Immunofluorescence SOS1 Antibody (SOS-01) - BSA Free
Species: Hu, Mu
Applications: ICC/IF, WB
RASGRF1 Antibody
NBP3-13291
Western Blot RASGRF1 Antibody
Immunohistochemistry-Paraffin RASGRF1 Antibody
Immunohistochemistry-Paraffin RASGRF1 Antibody
Species: Mu, Rt
Applications: WB
Tbp7 Antibody
NBP1-87799
Immunohistochemistry-Paraffin Tbp7 Antibody
Western Blot Tbp7 Antibody
Western Blot Tbp7 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
TOR/mTOR [p
Ser2448] Antibody
NB600-607
Immunohistochemistry-Paraffin TOR/mTOR [p Ser2448] Antibody
Western Blot TOR/mTOR [p Ser2448] Antibody
Data TOR/mTOR [p Ser2448] Antibody
(2 Reviews)
(9 Publications)
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
EIF5 Antibody
NBP2-16311
Western Blot EIF5 Antibody
Immunohistochemistry-Paraffin EIF5 Antibody
Western Blot EIF5 Antibody
(1 Review)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
eIF4A2 Antibody
NBP2-24529
Western Blot eIF4A2 Antibody
Immunohistochemistry-Paraffin eIF4A2 Antibody
Simple Western eIF4A2 Antibody
(1 Review)
(1 Publication)
Species: Ca, Ch, Hu, Mu, Pm
Applications: IHC, IHC-P, Simple Western, WB
GEF-H1 Antibody
NBP2-21577
Western Blot GEF-H1 Antibody
Western Blot GEF-H1 Antibody
Western Blot GEF-H1 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, WB
SLC2A4RG Antibody
(4C10)
H00056731-M02
Western Blot SLC2A4RG Antibody (4C10)
Immunocytochemistry/ Immunofluorescence SLC2A4RG Antibody (4C10)
Species: Hu
Applications: ELISA, ICC/IF, WB
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(49 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
ACOT12 Antibody
(OTI1A11)
NBP2-03605
Flow Cytometry ACOT12 Antibody (OTI1A11)
Flow Cytometry ACOT12 Antibody (OTI1A11)
Western Blot ACOT12 Antibody (OTI1A11)
Species: Hu
Applications: Flow, IHC, IHC-P, WB
IGF-I/IGF-1
[Unconjugated]
291-G1
SDS-PAGE IGF-I/IGF-1 [Unconjugated]
Bioactivity IGF-I/IGF-1 [Unconjugated]
Mass Spectrometry IGF-I/IGF-1 [Unconjugated]
(219 Publications)
Species: Hu
Applications: BA

Publications for EIF2 beta Antibody (NBP2-38483) (0)

There are no publications for EIF2 beta Antibody (NBP2-38483).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EIF2 beta Antibody (NBP2-38483) (0)

There are no reviews for EIF2 beta Antibody (NBP2-38483). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for EIF2 beta Antibody (NBP2-38483) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EIF2 beta Products

Research Areas for EIF2 beta Antibody (NBP2-38483)

Find related products by research area.

Blogs on EIF2 beta

There are no specific blogs for EIF2 beta, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EIF2 beta Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol EIF2S2
Uniprot