![Western Blot: eIF2B epsilon Antibody (5M2D4) [NBP3-16674] - Western blot analysis of extracts of various cell lines, using eIF2B epsilon (EIF2B5) Rabbit mAb (NBP3-16674) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.](http://images.novusbio.com/fullsize/eIF2B-epsilon-Antibody-5M2D4-Western-Blot-NBP3-16674-img0006.jpg "Western Blot: eIF2B epsilon Antibody (5M2D4) [NBP3-16674] - Western blot analysis of extracts of various cell lines, using eIF2B epsilon (EIF2B5) Rabbit mAb (NBP3-16674) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC |
| Clone | 5M2D4 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human eIF2B epsilon (Q13144). MAAPVVAPPGVVVSRANKRSGAGPGGSGGGGARGAEEEPPPPLQAVLVADSFDRRFFPISKDQPRVLLPLANVALIDYTLEFLTATGVQETFVFCCWKAA |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | EIF2B5 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 80 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for eIF2B epsilon Antibody (NBP3-16674)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | EIF2B5 |
![Immunocytochemistry/Immunofluorescence: eIF2B epsilon Antibody (5M2D4) [NBP3-16674] - Immunofluorescence analysis of U-2 OS cells using eIF2B epsilon (EIF2B5) Rabbit mAb (NBP3-16674) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/eIF2B-epsilon-Antibody-5M2D4-Immunocytochemistry-Immunofluorescence-NBP3-16674-img0005.jpg "Immunocytochemistry/Immunofluorescence: eIF2B epsilon Antibody (5M2D4) [NBP3-16674] - Immunofluorescence analysis of U-2 OS cells using eIF2B epsilon (EIF2B5) Rabbit mAb (NBP3-16674) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunohistochemistry-Paraffin: eIF2B epsilon Antibody (5M2D4) [NBP3-16674] - Analysis of eIF2B epsilon (EIF2B5) in paraffin-embedded human tonsil tissue using eIF2B epsilon (EIF2B5) Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16674_rabbit-eif2b-epsilon-mab-5m2d4-immunohistochemistry-paraffin-107202482855..jpg "Immunohistochemistry-Paraffin: eIF2B epsilon Antibody (5M2D4) [NBP3-16674] - Analysis of eIF2B epsilon (EIF2B5) in paraffin-embedded human tonsil tissue using eIF2B epsilon (EIF2B5) Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Immunohistochemistry-Paraffin: eIF2B epsilon Antibody (5M2D4) [NBP3-16674] - Analysis of eIF2B epsilon (EIF2B5) in paraffin-embedded human breast tissue using eIF2B epsilon (EIF2B5) Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16674_rabbit-eif2b-epsilon-mab-5m2d4-immunohistochemistry-paraffin-10720248301..jpg "Immunohistochemistry-Paraffin: eIF2B epsilon Antibody (5M2D4) [NBP3-16674] - Analysis of eIF2B epsilon (EIF2B5) in paraffin-embedded human breast tissue using eIF2B epsilon (EIF2B5) Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Immunohistochemistry-Paraffin: eIF2B epsilon Antibody (5M2D4) [NBP3-16674] - Analysis of eIF2B epsilon (EIF2B5) in paraffin-embedded human colon tissue using eIF2B epsilon (EIF2B5) Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16674_rabbit-eif2b-epsilon-mab-5m2d4-immunohistochemistry-paraffin-10720248319..jpg "Immunohistochemistry-Paraffin: eIF2B epsilon Antibody (5M2D4) [NBP3-16674] - Analysis of eIF2B epsilon (EIF2B5) in paraffin-embedded human colon tissue using eIF2B epsilon (EIF2B5) Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Immunohistochemistry-Paraffin: eIF2B epsilon Antibody (5M2D4) [NBP3-16674] - Analysis of eIF2B epsilon (EIF2B5) in paraffin-embedded human breast cancer tissue using eIF2B epsilon (EIF2B5) Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-16674_rabbit-eif2b-epsilon-mab-5m2d4-immunohistochemistry-paraffin-107202483227..jpg "Immunohistochemistry-Paraffin: eIF2B epsilon Antibody (5M2D4) [NBP3-16674] - Analysis of eIF2B epsilon (EIF2B5) in paraffin-embedded human breast cancer tissue using eIF2B epsilon (EIF2B5) Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Western Blot SOS2 Antibody [Unconjugated]](https://images.novusbio.com/images2/SOS2_AF6260_Western_Blot_9542.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot eIF4E [p Ser209] Antibody](https://images.novusbio.com/images/eIF4E-[p-Ser209]-Antibody-Western-Blot-NB100-81898-img0009.jpg)
![Immunocytochemistry/ Immunofluorescence eIF4E [p Ser209] Antibody](https://images.novusbio.com/images/eIF4E-[p-Ser209]-Antibody-Immunocytochemistry-Immunofluorescence-NB100-81898-img0005.jpg)
![Immunohistochemistry-Paraffin eIF4E [p Ser209] Antibody](https://images.novusbio.com/images/eIF4E-[p-Ser209]-Antibody-Immunohistochemistry-NB100-81898-img0006.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")