![Western Blot: EIF1A Antibody [NBP1-85808] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells). Lane 3: PC12 cell lysate (Pheochromocytoma of rat adrenal medulla).](http://images.novusbio.com/fullsize/EIF1AY-Antibody-Western-Blot-NBP1-85808-img0007.jpg "Western Blot: EIF1A Antibody [NBP1-85808] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells). Lane 3: PC12 cell lysate (Pheochromocytoma of rat adrenal medulla).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQ |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | EIF1AX |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry eIF5A Antibody [Unconjugated]](https://images.novusbio.com/images2/eIF5A_AF7558_Immunohistochemistry_22678.jpg)
![Immunohistochemistry eIF5A Antibody [Unconjugated]](https://images.novusbio.com/images2/eIF5A_AF7558_Immunohistochemistry_22679.jpg)
![Immunohistochemistry eIF5A Antibody [Unconjugated]](https://images.novusbio.com/images2/eIF5A_AF7558_Immunohistochemistry_22682.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | EIF1AX |
![Immunohistochemistry-Paraffin: EIF1A Antibody [NBP1-85808] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/EIF1AY-Antibody-Immunohistochemistry-Paraffin-NBP1-85808-img0012.jpg "Immunohistochemistry-Paraffin: EIF1A Antibody [NBP1-85808] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Western Blot: EIF1A Antibody [NBP1-85808] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize/EIF1AY-Antibody-Western-Blot-NBP1-85808-img0005.jpg "Western Blot: EIF1A Antibody [NBP1-85808] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp")
![Western Blot: EIF1A Antibody [NBP1-85808] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Mouse Cerebral Cortex tissue](http://images.novusbio.com/fullsize/EIF1AY-Antibody-Western-Blot-NBP1-85808-img0008.jpg "Western Blot: EIF1A Antibody [NBP1-85808] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Mouse Cerebral Cortex tissue")
![Immunohistochemistry-Paraffin: EIF1A Antibody [NBP1-85808] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/EIF1AY-Antibody-Immunohistochemistry-Paraffin-NBP1-85808-img0010.jpg "Immunohistochemistry-Paraffin: EIF1A Antibody [NBP1-85808] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.")
![Immunohistochemistry-Paraffin: EIF1A Antibody [NBP1-85808] - Staining of human endometrium shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/EIF1AY-Antibody-Immunohistochemistry-Paraffin-NBP1-85808-img0011.jpg "Immunohistochemistry-Paraffin: EIF1A Antibody [NBP1-85808] - Staining of human endometrium shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: EIF1A Antibody [NBP1-85808] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/EIF1AY-Antibody-Immunohistochemistry-Paraffin-NBP1-85808-img0013.jpg "Immunohistochemistry-Paraffin: EIF1A Antibody [NBP1-85808] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.")
![Western Blot eIF4E [p Ser209] Antibody](https://images.novusbio.com/images/eIF4E-[p-Ser209]-Antibody-Western-Blot-NB100-81898-img0009.jpg)
![Immunocytochemistry/ Immunofluorescence eIF4E [p Ser209] Antibody](https://images.novusbio.com/images/eIF4E-[p-Ser209]-Antibody-Immunocytochemistry-Immunofluorescence-NB100-81898-img0005.jpg)
![Immunohistochemistry-Paraffin eIF4E [p Ser209] Antibody](https://images.novusbio.com/images/eIF4E-[p-Ser209]-Antibody-Immunohistochemistry-NB100-81898-img0006.jpg)
![Immunohistochemistry CD55/DAF Antibody [Unconjugated]](https://images.novusbio.com/images2/CD55_AF2009_Immunohistochemistry_6728.jpg)
![Immunocytochemistry CD55/DAF Antibody [Unconjugated]](https://images.novusbio.com/images2/CD55_AF2009_Immunocytochemistry__Immunofluorescence_23052.jpg)
![Chromatin Immunoprecipitation (ChIP) Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct-3_4_AF1759_Chromatin_Immunoprecipitation_11218.jpg)
![Immunocytochemistry Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct-3_4_AF1759_Immunocytochemistry_7093.jpg)
![Simple Western Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct3_4_AF1759_Simple_Western_20183.jpg)
![Western Blot Brg1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Brg1_AF5738_Western_Blot_5829.jpg)
![Immunocytochemistry Brg1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Brg1_AF5738_Immunocytochemistry_11663.jpg)
![Immunocytochemistry Brg1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Brg1_AF5738_Immunocytochemistry_11664.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")