Novus Biologicals products are now on bio-techne.com

ECH1 Recombinant Protein Antigen

Name: ECH1 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-83215PEP
Price: 279 USD

Images

There are currently no images for ECH1 Protein (NBP1-83215PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

ECH1 Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ECH1. Source: E. coli Amino Acid Sequence: EVDVGLAADVGTLQRLPKVIGNQSLVNELAFTARKMMADEALGSGLVSRVFPDKEVMLDAALALAAEISSKSPVAVQSTKVNLLYSRDHSVAESLNYVASWNMSMLQTQDLVKSVQATTENKELKTVTF Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	ECH1
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83215. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	32 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ECH1 Recombinant Protein Antigen

delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial
delta3,5-delta2,4-dienoyl-CoA isomerase
dienoyl-CoA isomerase
EC 5.3.3.-
enoyl CoA hydratase 1, peroxisomal
enoyl Coenzyme A hydratase 1, peroxisomal
HPXEL
peroxisomal enoyl-CoA hydratase 1

Background

ECH1 encodes a member of the hydratase/isomerase superfamily. The gene product shows high sequence similarity to enoyl-coenzyme A (CoA) hydratases of several species, particularly within a conserved domain characteristic of these proteins. The encoded protein, which contains a C-terminal peroxisomal targeting sequence, localizes to the peroxisome. The rat ortholog, which localizes to the matrix of both the peroxisome and mitochondria, can isomerize 3-trans,5-cis-dienoyl-CoA to 2-trans,4-trans-dienoyl-CoA, indicating that it is a delta3,5-delta2,4-dienoyl-CoA isomerase. This enzyme functions in the auxiliary step of the fatty acid beta-oxidation pathway. Expression of the rat gene is induced by peroxisome proliferators.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Myosin Light Chain
2 Antibody

NBP1-85541

(1 Review)

(2 Publications)

Species: Hu, Mu

Applications: IHC, IHC-Fr, IHC-P, WB

Annexin A2
Antibody (1G7)

H00000302-M02

(1 Review)

(7 Publications)

Species: Hu, Mu

Applications: ELISA, Flow, ICC/IF, IP, WB

DLL3 Antibody

NBP2-24669

Immunohistochemistry-Paraffin DLL3 Antibody

(4 Publications)

Species: Hu, Mu, Pm

Applications: IHC, IHC-P, WB

PSMA1 Antibody

NBP1-81768

Immunohistochemistry-Paraffin PSMA1 Antibody

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

HMGCS2 Antibody

NBP2-33908

Immunohistochemistry-Paraffin HMGCS2 Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

COX5A Antibody

NBP1-32550

Immunohistochemistry-Paraffin COX5A Antibody

(3 Publications)

Species: Hu, Mu, Ze

Applications: ICC/IF, IHC, IHC-P, WB

ACAA2 Antibody
(OTI1C10)

NBP2-46477

Immunohistochemistry ACAA2 Antibody (OTI1C10)

Species: Ca, Hu, Pm, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

ECHS1 Antibody

NBP2-16263

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P, IP, WB

COX-2 Antibody

NB100-689

(1 Review)

(36 Publications)

Species: Hu, Rt

Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB

HSP27 Antibody
(G3.1)

NBP2-32972

Immunocytochemistry/ Immunofluorescence HSP27 Antibody (G3.1)

(1 Review)

(5 Publications)

Species: Ch, Pm, Hu, Pm, Mu, Rt, Sh

Applications: Flow, ICC/IF, IHC, IHC-P, WB

Aldehyde Oxidase
1/AOX1 Antibody [Unco ...

AF5928

Immunohistochemistry Aldehyde Oxidase 1/AOX1 Antibody [Unconjugated]

Immunocytochemistry Aldehyde Oxidase 1/AOX1 Antibody [Unconjugated]

Species: Hu

Applications: ICC, IHC, WB

MYL9 Antibody -
Azide and BSA Free

NBP2-94899

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, WB

Peroxiredoxin 3
Antibody

NBP2-19777

(1 Publication)

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P, KO, WB

Lipoprotein
Lipase/LPL Antibody [ ...

AF7197

Western Blot Lipoprotein Lipase/LPL Antibody [Unconjugated]

Immunocytochemistry Lipoprotein Lipase/LPL Antibody [Unconjugated]

(12 Publications)

Species: Hu, Mu

Applications: ICC, IHC, WB

Fast skeletal
myosin light chain 2 ...

NBP2-62625

Species: Hu

Applications: IHC, IHC-P

Plastin L Antibody

NBP2-19860

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB

BMP-4
[Unconjugated]

314-BP

(522 Publications)

Species: Hu

Applications: BA, BA

ERp57/PDIA3
Antibody

NBP1-84796

Immunohistochemistry-Paraffin ERp57/PDIA3 Antibody

(4 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, KD, WB

Insulin Antibody
(182410) [Unconjugate ...

MAB1417

Immunohistochemistry Insulin Antibody (182410) [Unconjugated]

(24 Publications)

Species: Bv, Hu, Mu

Applications: CyTOF-ready, ICC, IHC, ICFlow

iNOS Antibody -
BSA Free

NB300-605

(3 Reviews)

(130 Publications)

Species: Hu, Mu, Po, Rt

Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB

Publications for ECH1 Protein (NBP1-83215PEP) (0)

There are no publications for ECH1 Protein (NBP1-83215PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ECH1 Protein (NBP1-83215PEP) (0)

There are no reviews for ECH1 Protein (NBP1-83215PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ECH1 Protein (NBP1-83215PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ECH1 Products

Research Areas for ECH1 Protein (NBP1-83215PEP)

Find related products by research area.

Lipid and Metabolism

Blogs on ECH1

There are no specific blogs for ECH1, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Western Blot: iNOS Antibody [NB300-605] - Analysis of iNOS was performed by loading 20 ug of RAW264 whole cell lysate untreated (left lane) or stimulated with LPS at 1 ug/mL for 16 hours (right lane) and 10 uL of PageRuler Plus Prestained Protein Ladder onto a 4-20% Tris-Glycine polyacrylamide gel. Proteins were transferred to a nitrocellulose membrane and blocked with 5% Milk in TBST for at least 1 hour. The membrane was probed with an iNOS Rabbit polyclonal antibody at a dilution of 1:1000 overnight at 4C on a rocking platform, washed in TBST, and probed with a Goat anti-Rabbit IgG (H+L) Secondary Antibody, HRP conjugate at a dilution of 1:1000 for 1 hour. Chemiluminescent detection was performed using SuperSignal West Pico.

iNOS Antibody - BSA Free
NB300-605

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our ECH1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

ECH1

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

ECH1 Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

ECH1 Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for ECH1 Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for ECH1 Protein (NBP1-83215PEP) (0)

Reviews for ECH1 Protein (NBP1-83215PEP) (0)

FAQs for ECH1 Protein (NBP1-83215PEP) (0)

Additional ECH1 Products

Research Areas for ECH1 Protein (NBP1-83215PEP)

Blogs on ECH1

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics