Reactivity | HuSpecies Glossary |
Applications | AC |
Description | A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human E-Cadherin. Source: E. coli Amino Acid Sequence: ATDNGSPVATGTGTLLLILSDVNDNAPIPEPRTIFFCERNPKPQVINIIDADLPPNTSPFTAELTHGASANWTIQYNDPTQESIILKPKMALEVGDYKINLKLMDNQNKDQVTTLEVSVCDCEGA Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
Source | E. coli |
Protein/Peptide Type | Recombinant Protein Antigen |
Gene | CDH1 |
Purity | >80% by SDS-PAGE and Coomassie blue staining |
Dilutions |
|
Application Notes | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-34476. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com For further blocking tide related information and a protocol, click here. |
Theoretical MW | 31 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Storage | Store at -20C. Avoid freeze-thaw cycles. |
Buffer | PBS and 1M Urea, pH 7.4. |
Preservative | No Preservative |
Purity | >80% by SDS-PAGE and Coomassie blue staining |
Research Areas for E-Cadherin Recombinant Protein Antigen (NBP2-34476PEP)Find related products by research area.
|
Suppressing breast cancer metastasis: The role of hypoxia-induced RhoB expression and activation By Jamshed Arslan, Pharm. D., PhD. The Ras homologous (Rho) GTPase family of signaling molecules has over 20 members, which typically cycle between active (GTP-bound) and inactive (GDP-bound) states. These small GTPa... Read full blog post. |
Cathepsin B - a lysosomal protease with potential of an important drug target in neurological diseases and cancer Cathepsins are a family of lysosomal proteases (serine, aspartic and cysteine proteases) that acts in conjunction with lipases and nucleases to degrade biological macromolecules in the lysosomes (1). While most cathepsins are ubiquitously expressed... Read full blog post. |
SOX2 - a stem cell transcription factor The SOX gene family encodes a group of highly conserved transcription factors defined by the presence of a conserved high motility group (HMG) DNA-binding domain. They are involved in embryonic development regulation and cell fate determination. Al... Read full blog post. |
Beta-catenin - I am versatile! Beta-catenin is a cytosolic, 88 kDa intracellular protein associated with cell surface cadherin glycoproteins. It is a member of the larger calcium-dependent catenin family that includes alpha-catenin, beta-catenin, and gamma-catenin (also known as pl... Read full blog post. |
Vimentin: Regulating EMT and Cancer Vimentin, a member of the intermediate filament (IF) family, is a protein responsible for maintaining cellular integrity and reducing damage caused by stress. The vimentin protein is ubiquitously expressed in normal mesenchymal cells, and recent resea... Read full blog post. |
Carbonic Anhydrase IX Roles in Tumor Growth, Survival and Invasion Carbonic anhydrase IX (CAIX) is a membrane-associated carbonic anhydrase, strongly induced by hypoxia. CA IX is overexpressed by several cancer cells from many tumor types, and is a component of the pH regulatory system invoked by these cells to comba... Read full blog post. |
E-Cadherin as a Cancer Biomarker E-cadherin is a calcium-regulated adhesion molecule expressed in most normal epithelial tissues. E-cadherin is also associated with gland formation, stratification, and epithelial polarization, while loss of E-cadherin can cause dedifferentiation and ... Read full blog post. |
E-Cadherin in Cell-Cell Adhesion and Cancer Diagnostics E-Cadherin is a member of the cadherin superfamily and is fundamental player in a wide range of cellular processes such as development, morphology, polarity, migration and tissue integrity. Specifically, E-cadherin is an approximately 100 kDa epitheli... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | CDH1 |