![Immunohistochemistry-Paraffin: Dysferlin Antibody (CL10888) [NBP3-07994] - Analysis in human spleen and skin tissues using NBP3-07994 antibody. Corresponding Dysferlin RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Dysferlin-Antibody-CL10888-Immunohistochemistry-Paraffin-NBP3-07994-img0001.jpg "Immunohistochemistry-Paraffin: Dysferlin Antibody (CL10888) [NBP3-07994] - Analysis in human spleen and skin tissues using NBP3-07994 antibody. Corresponding Dysferlin RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clone | CL10888 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: CHYYYLPWGNVKPVVVLSSYWEDISHRIETQNQLLGIADRLEAGLEQVHLALKAQCSTEDVDSLVAQLTDELIAGCSQPLGDIHETPSATHLDQYLYQLRTHHLSQITEAALALKLGHSELPAALEQAEDWLLRLRALA |
| Epitope | VDSLVAQLTDELIAG |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | DYSF |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, pH 7.2, containing 40% glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Protein A purified |
![Choline Kinase beta [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Choline Kinase beta [Unconjugated]")
Secondary Antibodies |
Isotype Controls |
Research Areas for Dysferlin Antibody (NBP3-07994)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | DYSF |
![Western Blot: Dysferlin Antibody (CL10888) [NBP3-07994] - Analysis in human cell line RH-30.](http://images.novusbio.com/fullsize/Dysferlin-Antibody-CL10888-Western-Blot-NBP3-07994-img0006.jpg "Western Blot: Dysferlin Antibody (CL10888) [NBP3-07994] - Analysis in human cell line RH-30.")
![Immunohistochemistry-Paraffin: Dysferlin Antibody (CL10888) [NBP3-07994] - Staining of human spleen shows moderate positivity in cells in red pulp.](http://images.novusbio.com/fullsize/Dysferlin-Antibody-CL10888-Immunohistochemistry-Paraffin-NBP3-07994-img0005.jpg "Immunohistochemistry-Paraffin: Dysferlin Antibody (CL10888) [NBP3-07994] - Staining of human spleen shows moderate positivity in cells in red pulp.")
![Immunohistochemistry-Paraffin: Dysferlin Antibody (CL10888) [NBP3-07994] - Staining of human lymph node shows strong membranous positivity in non-germinal center cells and endothelial cells.](http://images.novusbio.com/fullsize/Dysferlin-Antibody-CL10888-Immunohistochemistry-Paraffin-NBP3-07994-img0002.jpg "Immunohistochemistry-Paraffin: Dysferlin Antibody (CL10888) [NBP3-07994] - Staining of human lymph node shows strong membranous positivity in non-germinal center cells and endothelial cells.")
![Immunohistochemistry-Paraffin: Dysferlin Antibody (CL10888) [NBP3-07994] - Staining of human placenta shows moderate membranous positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/Dysferlin-Antibody-CL10888-Immunohistochemistry-Paraffin-NBP3-07994-img0003.jpg "Immunohistochemistry-Paraffin: Dysferlin Antibody (CL10888) [NBP3-07994] - Staining of human placenta shows moderate membranous positivity in trophoblastic cells.")
![Immunohistochemistry-Paraffin: Dysferlin Antibody (CL10888) [NBP3-07994] - Staining of human skin shows no positivity in keratinocytes as expected.](http://images.novusbio.com/fullsize/Dysferlin-Antibody-CL10888-Immunohistochemistry-Paraffin-NBP3-07994-img0004.jpg "Immunohistochemistry-Paraffin: Dysferlin Antibody (CL10888) [NBP3-07994] - Staining of human skin shows no positivity in keratinocytes as expected.")
![Immunohistochemistry Dystroglycan Antibody [Unconjugated]](https://images.novusbio.com/images2/Dystroglycan_AF6868_Immunohistochemistry_11019.jpg)
![Western Blot Dystroglycan Antibody [Unconjugated]](https://images.novusbio.com/images2/Dystroglycan_AF6868_Western_Blot_11065.jpg)
![Knockout Validated Dystroglycan Antibody [Unconjugated]](https://images.novusbio.com/images2/Dystroglycan_AF6868_Knockout_Validated_23118.jpg)
![SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.](https://images.novusbio.com/images/Mouse-IgG1-Isotype-Control-MG1-SDS-Page-NBP1-97005-img0002.jpg "SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.")