![Western Blot: DUSP22 Antibody [NBP1-83078] - Analysis in control (vector only transfected HEK293T lysate) and DUSP22 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/DUSP22-Antibody-Western-Blot-NBP1-83078-img0007.jpg "Western Blot: DUSP22 Antibody [NBP1-83078] - Analysis in control (vector only transfected HEK293T lysate) and DUSP22 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFW |
| Predicted Species | Mouse (94%), Rat (91%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DUSP22 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for DUSP22 Antibody (NBP1-83078)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | DUSP22 |
![Immunocytochemistry/Immunofluorescence: DUSP22 Antibody [NBP1-83078] - Staining of human cell line A-431 shows localization to nucleoplasm & vesicles. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/DUSP22-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83078-img0006.jpg "Immunocytochemistry/Immunofluorescence: DUSP22 Antibody [NBP1-83078] - Staining of human cell line A-431 shows localization to nucleoplasm & vesicles. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: DUSP22 Antibody [NBP1-83078] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/DUSP22-Antibody-Immunohistochemistry-Paraffin-NBP1-83078-img0012.jpg "Immunohistochemistry-Paraffin: DUSP22 Antibody [NBP1-83078] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: DUSP22 Antibody [NBP1-83078] - Staining of human colon shows moderate to strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/DUSP22-Antibody-Immunohistochemistry-Paraffin-NBP1-83078-img0008.jpg "Immunohistochemistry-Paraffin: DUSP22 Antibody [NBP1-83078] - Staining of human colon shows moderate to strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: DUSP22 Antibody [NBP1-83078] - Staining of human pancreas shows very weak cytoplasmic positivity in exocrine glandular cells.](http://images.novusbio.com/fullsize/DUSP22-Antibody-Immunohistochemistry-Paraffin-NBP1-83078-img0010.jpg "Immunohistochemistry-Paraffin: DUSP22 Antibody [NBP1-83078] - Staining of human pancreas shows very weak cytoplasmic positivity in exocrine glandular cells.")
![Immunohistochemistry-Paraffin: DUSP22 Antibody [NBP1-83078] - Staining of human cerebral cortex shows moderate to strong nuclear positivity in neurons.](http://images.novusbio.com/fullsize/DUSP22-Antibody-Immunohistochemistry-Paraffin-NBP1-83078-img0009.jpg "Immunohistochemistry-Paraffin: DUSP22 Antibody [NBP1-83078] - Staining of human cerebral cortex shows moderate to strong nuclear positivity in neurons.")
![Immunohistochemistry-Paraffin: DUSP22 Antibody [NBP1-83078] - Staining of human placenta shows moderate to strong nuclear positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/DUSP22-Antibody-Immunohistochemistry-Paraffin-NBP1-83078-img0011.jpg "Immunohistochemistry-Paraffin: DUSP22 Antibody [NBP1-83078] - Staining of human placenta shows moderate to strong nuclear positivity in trophoblastic cells.")
![Western Blot JNK1 Antibody (228601) [Unconjugated]](https://images.novusbio.com/images2/JNK1_MAB17761_Western_Blot_5991.jpg)
![Western Blot JNK1 Antibody (228601) [Unconjugated]](https://images.novusbio.com/images2/JNK1_MAB17761_Western_Blot_6327.jpg)
![Immunocytochemistry JNK1 Antibody (228601) [Unconjugated]](https://images.novusbio.com/images2/JNK1_MAB17761_Immunocytochemistry__Immunofluorescence_20184.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Simple Western p38 alpha Antibody [Unconjugated]](https://images.novusbio.com/images2/16324.jpg)
![Western Blot p38 alpha Antibody [Unconjugated]](https://images.novusbio.com/images2/p38_alpha_AF8691_Western_Blot_22371.jpg)
![Immunohistochemistry p38 alpha Antibody [Unconjugated]](https://images.novusbio.com/images2/p38_alpha_AF8691_Immunohistochemistry_7087.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")