![Immunohistochemistry-Paraffin: DPEP1 Antibody [NBP1-86115] - Analysis in human small intestine and liver tissues using NBP1-86115 antibody. Corresponding DPEP1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/DPEP1-Antibody-Immunohistochemistry-Paraffin-NBP1-86115-img0010.jpg "Immunohistochemistry-Paraffin: DPEP1 Antibody [NBP1-86115] - Analysis in human small intestine and liver tissues using NBP1-86115 antibody. Corresponding DPEP1 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VMVNFYNNYISCTNKANLSQVADHLDHIKEVAGARAVGFGGDFDGVPRVPEGLEDVSKYPDLIAELLRRNWTEAEVKGALADNLLRVFQAVEQASNLTQAPEEEPIPLDQLGGSCRTHYGYSSGAS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DPEP1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Neutralization CXCL8/IL-8 Antibody (6217) [Unconjugated]](https://images.novusbio.com/images2/CXCL8_MAB208_Block_Neutralize_9064.jpg)
![Immunocytochemistry CXCL8/IL-8 Antibody (6217) [Unconjugated]](https://images.novusbio.com/images2/CXCL8_MAB208_Immunocytochemistry_9339.jpg)
![Western Blot CXCL8/IL-8 Antibody (6217) [Unconjugated]](https://images.novusbio.com/images2/mab208_human-il-8-cxcl8-mab-clone-6217-western-blot-1882021143847.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for DPEP1 Antibody (NBP1-86115)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | DPEP1 |
![Immunohistochemistry-Paraffin: DPEP1 Antibody [NBP1-86115] - Staining of human colon, kidney, liver and testis using Anti-DPEP1 antibody NBP1-86115 (A) shows similar protein distribution across tissues to independent antibody NBP1-86087 (B).](http://images.novusbio.com/fullsize/DPEP1-Antibody-Western-Blot-NBP1-86115-img0008.jpg "Immunohistochemistry-Paraffin: DPEP1 Antibody [NBP1-86115] - Staining of human colon, kidney, liver and testis using Anti-DPEP1 antibody NBP1-86115 (A) shows similar protein distribution across tissues to independent antibody NBP1-86087 (B).")
![Western Blot: DPEP1 Antibody [NBP1-86115] - Analysis in control (vector only transfected HEK293T lysate) and DPEP1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/DPEP1-Antibody-Western-Blot-NBP1-86115-img0007.jpg "Western Blot: DPEP1 Antibody [NBP1-86115] - Analysis in control (vector only transfected HEK293T lysate) and DPEP1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
![Immunohistochemistry-Paraffin: DPEP1 Antibody [NBP1-86115] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/DPEP1-Antibody-Immunohistochemistry-Paraffin-NBP1-86115-img0015.jpg "Immunohistochemistry-Paraffin: DPEP1 Antibody [NBP1-86115] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: DPEP1 Antibody [NBP1-86115] - Staining of human small intestine whos strong positivity in apical membrane glandular cells.](http://images.novusbio.com/fullsize/DPEP1-Antibody-Immunohistochemistry-Paraffin-NBP1-86115-img0012.jpg "Immunohistochemistry-Paraffin: DPEP1 Antibody [NBP1-86115] - Staining of human small intestine whos strong positivity in apical membrane glandular cells.")
![Immunohistochemistry-Paraffin: DPEP1 Antibody [NBP1-86115] - Staining of human kidney shows strong membranous and cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/DPEP1-Antibody-Immunohistochemistry-Paraffin-NBP1-86115-img0013.jpg "Immunohistochemistry-Paraffin: DPEP1 Antibody [NBP1-86115] - Staining of human kidney shows strong membranous and cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: DPEP1 Antibody [NBP1-86115] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.](http://images.novusbio.com/fullsize/DPEP1-Antibody-Immunohistochemistry-Paraffin-NBP1-86115-img0014.jpg "Immunohistochemistry-Paraffin: DPEP1 Antibody [NBP1-86115] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.")
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![SDS-PAGE IL-1 beta/IL-1F2 [Unconjugated]](https://images.novusbio.com/images2/IL-1_beta_201-LB_304.jpg)
![Bioactivity IL-1 beta/IL-1F2 [Unconjugated]](https://images.novusbio.com/images2/IL-1_beta_201-LB_306.jpg)
![SEC-MALS IL-1 beta/IL-1F2 [Unconjugated]](https://images.novusbio.com/images/201-lb_recombinant-human-il-1-beta-il-1f2-protein-sec-mals-123202491556.jpg)
![Bioactivity IFN-gamma [Unconjugated]](https://images.novusbio.com/images2/IFNgamma_285IF_2848.jpg)
![SDS-PAGE IFN-gamma [Unconjugated]](https://images.novusbio.com/images2/IFN-gamma_285-IF_230.jpg)
![SEC-MALS IFN-gamma [Unconjugated]](https://images.novusbio.com/images/285-if_recombinant-human-ifn-gamma-protein-sec-mals-1520239228..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")