Reactivity | HuSpecies Glossary |
Applications | IHC |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GKVHAMSNWVCYLCLPSSRSGLLQRRRKWRSQLKAFYDRESENPLEMFETVPVWRRQPVRVL |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | DNMT3L |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Dnmt3L antibody validated for IHC-P from a verified customer review. |
||
Control Peptide |
|
||
Reviewed Applications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Images | Ratings | Applications | Species | Date | Details | ||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
IHC-P | Human | 08/03/2017 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for Dnmt3L Antibody (NBP2-39076)Find related products by research area.
|
The role of DNMT3B in the co-incidence of methyltransferase and tumor suppressor expression in malignancies Epigenetics is the process of heritable change in gene activity despite alteration of the hosts DNA sequence, essentially causing a change in a phenotype without a change in the genotype of a host. To change the gene sequence without interfering w... Read full blog post. |
The role of DNMT3A in development Epigenetics is the study of heritable change in gene activity despite alteration of the hosts DNA sequence. Change in gene activity done independently of the DNA sequence is achieved by way of histone and DNA methylation. Gene silencing in DNA ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.