![Immunohistochemistry-Paraffin: DMC1 Antibody [NBP1-82838] - Analysis in human testis and pancreas tissues using NBP1-82838 antibody. Corresponding DMC1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/DMC1-Antibody-Immunohistochemistry-Paraffin-NBP1-82838-img0010.jpg "Immunohistochemistry-Paraffin: DMC1 Antibody [NBP1-82838] - Analysis in human testis and pancreas tissues using NBP1-82838 antibody. Corresponding DMC1 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AYTSEHQMELLDYVAAKFHEEAGIFKLLIIDSIMALFRVDFSGRGELAERQQKLAQMLSRLQKISEEYNVAVFVTNQMTADPGATMTFQADPKKPIGGHILAHASTTRISLRKGRGELRIAKIYDSPEMPENEATFAITA |
| Predicted Species | Mouse (100%), Rat (99%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DMC1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Flow Cytometry ERMAP Antibody [Unconjugated]](https://images.novusbio.com/images2/ERMAP_AF4928_Flow_Cytometry_11957.jpg)
![Western Blot Rad17 [p Ser645] Antibody](https://images.novusbio.com/images/Rad17-[p-Ser645]-Antibody-Western-Blot-NBP2-24457-img0001.jpg)
![Immunohistochemistry-Paraffin Rad17 [p Ser645] Antibody](https://images.novusbio.com/images/Rad17-[p-Ser645]-Antibody-Immunohistochemistry-Paraffin-NBP2-24457-img0003.jpg)
![Western Blot Rad17 [p Ser645] Antibody](https://images.novusbio.com/images/Rad17-[p-Ser645]-Antibody-Western-Blot-NBP2-24457-img0005.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for DMC1 Antibody (NBP1-82838)Find related products by research area.
|
|
Determining DMC1's role in Homologus Recombination The DMC1 gene encodes a 36.7 kDa nuclear protein involved in meiotic homologous recombination. This recombinase is functionally related to the yeast RAD51 and E. coli RecA genes. In contrast to RAD51, which functions in both mitotic and meiotic recomb... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | DMC1 |
![Immunohistochemistry-Paraffin: DMC1 Antibody [NBP1-82838] - Staining of human duodenum shows no expression in glandular cells as expected.](http://images.novusbio.com/fullsize/DMC1-Antibody-Immunohistochemistry-Paraffin-NBP1-82838-img0014.jpg "Immunohistochemistry-Paraffin: DMC1 Antibody [NBP1-82838] - Staining of human duodenum shows no expression in glandular cells as expected.")
![Immunohistochemistry-Paraffin: DMC1 Antibody [NBP1-82838] - Staining of human testis shows moderate nuclear positivity in a subset of cells in seminiferious ducts.](http://images.novusbio.com/fullsize/DMC1-Antibody-Immunohistochemistry-Paraffin-NBP1-82838-img0011.jpg "Immunohistochemistry-Paraffin: DMC1 Antibody [NBP1-82838] - Staining of human testis shows moderate nuclear positivity in a subset of cells in seminiferious ducts.")
![Immunohistochemistry-Paraffin: DMC1 Antibody [NBP1-82838] - Staining of human pancreas shows no expression in exocrine glandular cells as expected.](http://images.novusbio.com/fullsize/DMC1-Antibody-Immunohistochemistry-Paraffin-NBP1-82838-img0012.jpg "Immunohistochemistry-Paraffin: DMC1 Antibody [NBP1-82838] - Staining of human pancreas shows no expression in exocrine glandular cells as expected.")
![Immunohistochemistry-Paraffin: DMC1 Antibody [NBP1-82838] - Staining of human liver shows no expression in hepatocytes as expected.](http://images.novusbio.com/fullsize/DMC1-Antibody-Immunohistochemistry-Paraffin-NBP1-82838-img0013.jpg "Immunohistochemistry-Paraffin: DMC1 Antibody [NBP1-82838] - Staining of human liver shows no expression in hepatocytes as expected.")
![Western Blot BRCA2 Antibody (234403) [Unconjugated]](https://images.novusbio.com/images2/BRCA2_MAB2476_Western_Blot_6033.jpg)
![Immunohistochemistry BRCA2 Antibody (234403) [Unconjugated]](https://images.novusbio.com/images2/mab2476_human-brca2-mab-clone-234403-immunohistochemistry-10520211657.jpg)
![Western Blot BRCA2 Antibody (234403) [Unconjugated]](https://images.novusbio.com/images/mab2476_human-brca2-mab-clone-234403-2282024172111.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")