Home » DMBT1/GP340 » DMBT1 Peptides and Proteins » DMBT1/GP340 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

DMBT1/GP340 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for DMBT1/GP340 Recombinant Protein Antigen (NBP2-38471PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

DMBT1/GP340 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DMBT1.

Source: E. coli

Amino Acid Sequence: STPAPFLNITRPNTDYSCGGFLSQPSGDFSSPFYPGNYPNNAKCVWDIEVQNNYRVTVIFRDVQLEGGCNYDYIEVFDGPYRSSPLIARVCDGAR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DMBT1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38471.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DMBT1/GP340 Recombinant Protein Antigen

  • CRP-ductin
  • deleted in malignant brain tumors 1 protein
  • deleted in malignant brain tumors 1
  • DMBT1
  • Ebnerin
  • FLJ61058
  • Glycoprotein 340
  • GP340
  • gp-340
  • GP340muclin
  • Hensin
  • MGC164738
  • Muclin
  • SAG
  • Salivary agglutinin
  • Surfactant pulmonary-associated D-binding protein
  • Vomeroglandin

Background

Glycoprotein-340 is member of the scavenger receptor superfamily and has been identified as a putative SP-D receptor. Gp-340 has been shown to bind SP-D in a calcium dependent manner through a protein-protein interaction. Like SP-D, gp-340 is mainly found in lung tissue and immunohistochemistry revealed high expression in alveolar macrophages (1). An identical protein is present in saliva (salivary agglutinin) and both forms are encoded by the gene DMBT1 (5).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

RNF7 Antibody
NBP1-85594
Western Blot RNF7 Antibody
Immunocytochemistry/ Immunofluorescence RNF7 Antibody
Immunohistochemistry-Paraffin RNF7 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
SP-D [HRP]
DSFPD0
N/A SP-D [HRP]
N/A SP-D [HRP]
N/A SP-D [HRP]
(9 Publications)
Species: Hu
Applications: ELISA
PTEN Antibody
[Unconjugated]
AF847
Western Blot PTEN Antibody [Unconjugated]
Simple Western PTEN Antibody [Unconjugated]
Knockout Validated PTEN Antibody [Unconjugated]
(16 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, KO, Simple Western, WB
CD4 Antibody - BSA
Free
NBP1-19371
Immunohistochemistry-Frozen CD4 Antibody - BSA Free
Immunohistochemistry-Paraffin CD4 Antibody - BSA Free
Flow Cytometry CD4 Antibody - BSA Free
(9 Reviews)
(50 Publications)
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
IFN-gamma
[Unconjugated]
285-IF
Bioactivity IFN-gamma [Unconjugated]
SDS-PAGE IFN-gamma [Unconjugated]
SEC-MALS IFN-gamma [Unconjugated]
(2 Reviews)
(454 Publications)
Species: Hu
Applications: BA
Sonic Hedgehog/Shh
[Unconjugated]
464-SH
Bioactivity Sonic Hedgehog/Shh [Unconjugated]
SDS-PAGE Sonic Hedgehog/Shh [Unconjugated]
SEC-MALS Sonic Hedgehog/Shh [Unconjugated]
(69 Publications)
Species: Mu
Applications: BA
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
MUC5B Antibody
NBP1-92151
Immunohistochemistry-Paraffin MUC5B Antibody
Immunohistochemistry-Paraffin MUC5B Antibody
Immunohistochemistry-Paraffin MUC5B Antibody
(9 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Catalase Antibody
[Unconjugated]
AF3398
Western Blot Catalase Antibody [Unconjugated]
Simple Western Catalase Antibody [Unconjugated]
Knockout Validated Catalase Antibody [Unconjugated]
(3 Reviews)
(15 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
SR-BI Antibody -
BSA Free
NB400-104
Immunohistochemistry-Paraffin SR-BI Antibody - BSA Free
Knockdown Validated SR-BI Antibody - BSA Free
Western Blot SR-BI Antibody - BSA Free
(5 Reviews)
(234 Publications)
Species: ChHa, SyHa, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, PLA, Simple Western, WB
CD8 Antibody
(53-6.7) - BSA Free
NBP1-49045
Immunohistochemistry-Paraffin CD8 Antibody (53-6.7) - BSA Free
Immunocytochemistry/ Immunofluorescence CD8 Antibody (53-6.7) - BSA Free
Immunohistochemistry-Frozen CD8 Antibody (53-6.7) - BSA Free
(3 Reviews)
(28 Publications)
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
ATP7b Antibody -
BSA Free
NB100-360
Immunocytochemistry/ Immunofluorescence ATP7b Antibody - BSA Free
Western Blot ATP7b Antibody - BSA Free
Immunohistochemistry ATP7b Antibody - BSA Free
(1 Review)
(22 Publications)
Species: Hu, Mu, Rt
Applications: IB, ICC/IF, IHC, IHC-P, IP, WB
Lactoferrin
Antibody (1C6cc)
NB120-10109
CyTOF-ready Lactoferrin Antibody (1C6cc)
(1 Review)
(1 Publication)
Species: Hu
Applications: CyTOF-ready, IHC, IHC-P, S-ELISA, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(818 Publications)
Species: Hu
Applications: BA
CRAT Antibody
NBP1-86616
Western Blot CRAT Antibody
Western Blot CRAT Antibody
Immunohistochemistry-Paraffin CRAT Antibody
(2 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
EGFR Antibody
[Unconjugated]
AF231
Immunohistochemistry EGFR Antibody [Unconjugated]
Immunocytochemistry EGFR Antibody [Unconjugated]
Western Blot EGFR Antibody [Unconjugated]
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
GLYAT Antibody
NBP2-58917
Western Blot GLYAT Antibody
Immunohistochemistry-Paraffin GLYAT Antibody
Immunohistochemistry-Paraffin GLYAT Antibody
Species: Hu
Applications: IHC, IHC-P, WB
IL-2 [Unconjugated]
202-IL
Bioactivity IL-2 [Unconjugated]
(4 Reviews)
(377 Publications)
Species: Hu
Applications: BA
PKD2L1 Antibody
(4F9)
H00009033-M01
Western Blot PKD2L1 Antibody (4F9)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, PAGE, WB
DMBT1/GP340
Recombinant Protein A
NBP2-38471PEP
DMBT1/GP340 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for DMBT1/GP340 Recombinant Protein Antigen (NBP2-38471PEP) (0)

There are no publications for DMBT1/GP340 Recombinant Protein Antigen (NBP2-38471PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DMBT1/GP340 Recombinant Protein Antigen (NBP2-38471PEP) (0)

There are no reviews for DMBT1/GP340 Recombinant Protein Antigen (NBP2-38471PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DMBT1/GP340 Recombinant Protein Antigen (NBP2-38471PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DMBT1/GP340 Products

Research Areas for DMBT1/GP340 Recombinant Protein Antigen (NBP2-38471PEP)

Find related products by research area.

Blogs on DMBT1/GP340

There are no specific blogs for DMBT1/GP340, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Recombinant Human IFN-gamma (Catalog # 285‑IF) demonstrates anti-viral activity in HeLa human cervical epithelial carcinoma cells infected with encephalomyocarditis (EMC) virus. The activity is over 2-fold greater than the top competitor's IFN-gamma .
IFN-gamma [Unconjugated]
285-IF-100
As an alternative, please consider our next generation Recombinant Human IL-2 (BT-002). It has equivalent bioactivity to Recombinant Human IL-2 (Catalog # 202-IL). It combines R&D Systems quality with scalability that allows for a solid supply chain. Both Recombinant Human IL-2 proteins are measured in a cell proliferation assay using CTLL 2 mouse cytotoxic T cells.
IL-2 [Unconjugated]
202-IL-010

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DMBT1/GP340 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol DMBT1