![Immunohistochemistry-Paraffin: DLL4 Antibody [NBP1-86413] - Staining of human small intestine shows strong membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/DLL4-Antibody-Immunohistochemistry-Paraffin-NBP1-86413-img0003.jpg "Immunohistochemistry-Paraffin: DLL4 Antibody [NBP1-86413] - Staining of human small intestine shows strong membranous positivity in glandular cells.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: CHDLENGLMCTCPAGFSGRRCEVRTSIDACASSPCFNRATCYTDLSTDTFVCNCPYGFVGSRCEFPVGL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DLL4 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-86413 | Applications | Species |
|---|---|---|
| Vo K, Amarasinghe B, Washington K et al. Targeting notch pathway enhances rapamycin antitumor activity in pancreas cancers through PTEN phosphorylation. Mol Cancer 2011-11-01 [PMID: 22074495] |
Secondary Antibodies |
Isotype Controls |
Research Areas for DLL4 Antibody (NBP1-86413)Find related products by research area.
|
|
New DLL4 Vaccine May Prevent Breast Tumors We at Novus Biologicals have a large antibody database devoted to signalling pathways. These underpin every area of molecular biological research, including cancer. Among our cell signalling antibodies is one targeted to DLL4 (Delta-like protein 4). D... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | DLL4 |
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
![Immunocytochemistry Notch-4 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af3847_human-notch-4-intracellular-domain-affinity-purified-pab-immunocytochemistry-3092021102949.jpg)
![Western Blot Pref-1/DLK1/FA1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Pref1_AF8277_Flow_Cytometry_15135.jpg)
![Immunohistochemistry Pref-1/DLK1/FA1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Pref1_AF8277_Immunohistochemistry_15186.jpg)
![Flow Cytometry Pref-1/DLK1/FA1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Pref1_AF8277_Flow_Cytometry_15223.jpg)
![Flow Cytometry Notch-3 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af1308_mouse-notch-3-affinity-purified-polyclonal-ab-flow-cytometry-1272024151031..jpg)
![Immunohistochemistry Notch-3 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af1308_mouse-notch-3-affinity-purified-polyclonal-ab-immunohistochemistry-711202484012..jpg)
![Immunofluorescence Notch-3 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af1308_mouse-notch-3-affinity-purified-polyclonal-ab-immunofluorescence-711202484352..jpg)
![Western Blot Butyrylcholinesterase/BCHE Antibody [Unconjugated]](https://images.novusbio.com/images2/Butyrylcholinesterase_AF9024_Western_Blot_19121.jpg)
![Immunohistochemistry Butyrylcholinesterase/BCHE Antibody [Unconjugated]](https://images.novusbio.com/images2/Butyrylcholinesterase_AF9024_Immunohistochemistry_19158.jpg)
![Immunohistochemistry Notch-2 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af3735_human-notch-2-intracellular-domain-affinity-purified-pab-immunohistochemistry-1862024111356..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")