Dkk-2 Recombinant Protein Antigen Summary
Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Dkk-2. Source: E. coli
Amino Acid Sequence: MCCPSTRCNNGICIPVTESILTPHIPALDGTRHRDRNHGHYSNHDLGWQNLGRPHTKMSHIKGHEGDPCLRSSDCIEGFCC Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
Source |
E. coli |
Protein/Peptide Type |
Recombinant Protein Antigen |
Gene |
DKK2 |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
Dilutions |
- Antibody Competition 10-100 molar excess
|
Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-68703. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com For further blocking tide related information and a protocol, click here. |
Theoretical MW |
27 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS and 1M Urea, pH 7.4. |
Preservative |
No Preservative |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for Dkk-2 Recombinant Protein Antigen
Background
Analysis of individual DKK domains and chimeric DKKs shows that the carboxy-terminal domains of both DKK1 and DKK2 associate with LRP6 and are necessary and sufficient for Wnt8 inhibition. Xenopus Dickkopf 1 (DKK1) was initially discovered as a Wnt antagonist that plays an important role in head formation. By far, four members of DKK have been identified in mammals. Each DKK molecule contains two conserved cysteine-rich domains. Recent studies showed that the second Cys-rich domains of DKK1 and DKK2 inhibited Wnt3a-activated signaling, whereas the first Cys-rich domains had no effects. In addition, the second Cys-rich domain of DKK2, but not that of DKK1, was able to activate the canonical pathway in the presence of LRP6, and this LRP-dependent signaling does not require Dvl.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ELISA, IHC
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: BA
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: Bind
Species: Hu
Applications: BA
Species: Hu
Applications: BA, BA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Publications for Dkk-2 Recombinant Protein Antigen (NBP2-68703PEP) (0)
There are no publications for Dkk-2 Recombinant Protein Antigen (NBP2-68703PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Dkk-2 Recombinant Protein Antigen (NBP2-68703PEP) (0)
There are no reviews for Dkk-2 Recombinant Protein Antigen (NBP2-68703PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Dkk-2 Recombinant Protein Antigen (NBP2-68703PEP) (0)
Additional Dkk-2 Products
Blogs on Dkk-2