Home » Decorin » Decorin Proteins » Decorin Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Decorin Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Decorin Recombinant Protein Antigen (NBP2-56346PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Decorin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Decorin.

Source: E. coli

Amino Acid Sequence: VSPGAFTPLVKLERLYLSKNQLKELPEKMPKTLQELRAHENEITKVRKVTFNGLNQMIVIELGTNPLKSSGIENGAFQGMKKLSY

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DCN
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56346.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Decorin Recombinant Protein Antigen

  • Bone proteoglycan II
  • CSCD
  • DCN
  • decorin proteoglycan
  • Decorin
  • dermatan sulphate proteoglycans II
  • DSPG2
  • PG40
  • PGII
  • PG-II
  • PGS2
  • PG-S2
  • proteoglycan core protein
  • SLRR1B
  • SLRR1BPGS2
  • small leucine-rich protein 1B

Background

Decorin is encoded by this gene is a small cellular or pericellular matrix proteoglycan that is closely related in structure to biglycan protein. The encoded protein and biglycan are thought to be the result of a gene duplication. This protein is a component of connective tissue, binds to type I collagen fibrils, and plays a role in matrix assembly. It contains one attached glycosaminoglycan chain. This protein is capable of suppressing the growth of various tumor cell lines. There are multiple alternatively spliced transcript variants known for this gene. This gene is a candidate gene for Marfan syndrome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Biglycan Antibody
AF2667
Immunohistochemistry Biglycan Antibody
Immunocytochemistry/ Immunofluorescence Biglycan Antibody
(17 Publications)
Species: Hu
Applications: IHC, WB
Versican Antibody
[Unconjugated] - Isof ...
AF3054
Immunocytochemistry Versican Antibody [Unconjugated] - Isoform V0
Immunocytochemistry Versican Antibody [Unconjugated] - Isoform V0
Immunocytochemistry/ Immunofluorescence Versican Antibody [Unconjugated] - Isoform V0
(8 Publications)
Species: Hu
Applications: ICC, IHC, WB
Aggrecan
Neoepitope Antibody -
NB100-74350
Western Blot Aggrecan Neoepitope Antibody - BSA Free
Western Blot Aggrecan Neoepitope Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Aggrecan Neoepitope Antibody - BSA Free
(32 Publications)
Species: Bv, Ca, Hu, Mu, Po, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Fibronectin
Antibody - BSA Free
NBP1-91258
Western Blot Fibronectin Antibody - BSA Free
Western Blot Fibronectin Antibody - BSA Free
Western Blot Fibronectin Antibody - BSA Free
(11 Reviews)
(56 Publications)
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Fibromodulin/FMOD
Antibody
AF5945
Western Blot Fibromodulin/FMOD Antibody
Species: Hu, Mu, Rt
Applications: WB
Lumican Antibody
[Unconjugated]
AF2846
Western Blot Lumican Antibody [Unconjugated]
Immunohistochemistry Lumican Antibody [Unconjugated]
(15 Publications)
Species: Hu
Applications: IHC, WB
ABCB6 Antibody
NBP1-91642
Immunohistochemistry-Paraffin ABCB6 Antibody
Immunocytochemistry/ Immunofluorescence ABCB6 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Osteopontin/OPN
Antibody [Unconjugate
AF808
Immunocytochemistry Osteopontin/OPN Antibody [Unconjugated]
Neutralization Osteopontin/OPN Antibody [Unconjugated]
Immunohistochemistry Osteopontin/OPN Antibody [Unconjugated]
(2 Reviews)
(205 Publications)
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB

N-Acetylgalactosamine- ...
NBP1-32899
Western Blot N-Acetylgalactosamine-6-Sulfatase/GALNS Antibody
Western Blot N-Acetylgalactosamine-6-Sulfatase/GALNS Antibody
Immunocytochemistry/ Immunofluorescence N-Acetylgalactosamine-6-Sulfatase/GALNS Antibody
(2 Reviews)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
EGFR Antibody
[Unconjugated]
AF231
Immunohistochemistry EGFR Antibody [Unconjugated]
Immunocytochemistry EGFR Antibody [Unconjugated]
Western Blot EGFR Antibody [Unconjugated]
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin p21/CIP1/CDKN1A Antibody (WA-1)
(24 Publications)
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
SPARC Antibody
[Unconjugated]
AF942
Western Blot SPARC Antibody [Unconjugated]
Immunohistochemistry SPARC Antibody [Unconjugated]
Immunocytochemistry SPARC Antibody [Unconjugated]
(38 Publications)
Species: Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow, WB
Glucose 6
phosphate isomerase A ...
NBP2-02541
Western Blot Glucose 6 phosphate isomerase Antibody (OTI2D2)
Immunohistochemistry-Paraffin Glucose 6 phosphate isomerase Antibody (OTI2D2)
Immunohistochemistry-Paraffin Glucose 6 phosphate isomerase Antibody (OTI2D2)
(1 Publication)
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Catalase Antibody
[Unconjugated]
AF3398
Western Blot Catalase Antibody [Unconjugated]
Simple Western Catalase Antibody [Unconjugated]
Knockout Validated Catalase Antibody [Unconjugated]
(3 Reviews)
(15 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
DHPS Antibody
NBP1-82648
Immunocytochemistry/ Immunofluorescence DHPS Antibody
Western Blot DHPS Antibody
Immunohistochemistry-Paraffin DHPS Antibody
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Dehydrodolichyl
Diphosphate Synthase ...
NBP1-87964
Immunohistochemistry-Paraffin Dehydrodolichyl Diphosphate Synthase Antibody
Immunohistochemistry-Paraffin Dehydrodolichyl Diphosphate Synthase Antibody
Immunohistochemistry-Paraffin Dehydrodolichyl Diphosphate Synthase Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
Peripherin 2/PRPH2
Antibody
NBP1-86687
Western Blot Peripherin 2/PRPH2 Antibody
Immunohistochemistry-Paraffin Peripherin 2/PRPH2 Antibody
Immunohistochemistry-Paraffin Peripherin 2/PRPH2 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
Syndecan-1/CD138
Antibody
AF2780
Immunohistochemistry Syndecan-1/CD138 Antibody
Immunohistochemistry Syndecan-1/CD138 Antibody
(1 Review)
(13 Publications)
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, WB

Publications for Decorin Recombinant Protein Antigen (NBP2-56346PEP) (0)

There are no publications for Decorin Recombinant Protein Antigen (NBP2-56346PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Decorin Recombinant Protein Antigen (NBP2-56346PEP) (0)

There are no reviews for Decorin Recombinant Protein Antigen (NBP2-56346PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Decorin Recombinant Protein Antigen (NBP2-56346PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Decorin Products

Research Areas for Decorin Recombinant Protein Antigen (NBP2-56346PEP)

Find related products by research area.

Blogs on Decorin

There are no specific blogs for Decorin, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Osteopontin/OPN was detected in immersion fixed C2C12 mouse myoblast cell line (left panel, positive stain) and mouse splenocytes (right panel, negative stain) using Goat Anti-Mouse Osteopontin/OPN Antigen Affinity-purified Polyclonal Antibody (Catalog # AF808) at 5 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; NL001) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm and secreted molecule. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Osteopontin/OPN Antibody [Unconjugated]
AF808
Western Blot: Fibronectin Antibody - BSA Free [NBP1-91258] - Nicotinamide (NAM) attenuates unilateral urethral obstruction (UUO)-induced renal interstitial fibrosis. C57BL/6 mice were subjected to UUO surgery or sham operation. Different doses of NAM or saline were intraperitoneally injected an hour before the surgery and daily thereafter. Representative images of Western blot of FN (fibronectin), alpha-SMA (alpha-smooth muscle actin) and GAPDH (loading control). Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30993884/) licensed under a CC-BY license.
Fibronectin Antibody - BSA Free
NBP1-91258

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Decorin Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol DCN