Home » DAX1/NR0B1 » DAX1/NR0B1 Proteins » DAX1/NR0B1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

DAX1/NR0B1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for DAX1/NR0B1 Recombinant Protein Antigen (NBP2-68781PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

DAX1/NR0B1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DAX1/NR0B1.

Source: E. coli

Amino Acid Sequence: GKDHPRQGSILYSMLTSAKQTYAAPKAPEATLGPCWGCSCGSDPGVGRAGLPGGRPVALLYRCCF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NR0B1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-68781.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DAX1/NR0B1 Recombinant Protein Antigen

  • AHC
  • AHCDSS
  • AHCH
  • AHX
  • DAX1
  • DAX1DAX-1
  • dosage-sensitive sex reversal
  • DSS-AHC critical region on the X chromosome protein 1
  • GTD
  • HHG
  • NR0B1
  • NROB1
  • nuclear hormone receptor
  • Nuclear receptor DAX-1
  • nuclear receptor subfamily 0 group B member 1
  • nuclear receptor subfamily 0, group B, member 1

Background

NR0B1 encodes a protein that contains a DNA-binding domain. The encoded protein acts as a dominant-negative regulator of transcription which is mediated by the retinoic acid receptor. This protein also functions as an anti-testis gene by acting antagonistically to Sry. Mutations in this gene result in both X-linked congenital adrenal hypoplasia and hypogonadotropic hypogonadism.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...


SF-1/NR5A1/Steroidogen ...
NBP1-52823
Immunohistochemistry-Paraffin SF-1/NR5A1/Steroidogenic Factor 1 Antibody
Western Blot SF-1/NR5A1/Steroidogenic Factor 1 Antibody
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(818 Publications)
Species: Hu
Applications: BA

Myeloperoxidase/MPO An ...
AF3667
Western Blot Myeloperoxidase/MPO Antibody [Unconjugated]
Simple Western Myeloperoxidase/MPO Antibody [Unconjugated]
Immunocytochemistry Myeloperoxidase/MPO Antibody [Unconjugated]
(3 Reviews)
(167 Publications)
Species: Hu, Mu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB
MID1 Antibody
NBP1-26612
Western Blot MID1 Antibody
(2 Publications)
Species: Hu
Applications: IP (-), WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(667 Publications)
Species: Mu
Applications: ELISA
IL-10 [Biotin]
DY417
N/A IL-10 [Biotin]
(302 Publications)
Species: Mu
Applications: ELISA
Splicing Factor 1
Antibody (2E12)
H00007536-M01
Western Blot Splicing Factor 1 Antibody (2E12)
Western Blot Splicing Factor 1 Antibody (2E12)
Immunocytochemistry/ Immunofluorescence Splicing Factor 1 Antibody (2E12)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
SOX9 Antibody
[Unconjugated]
AF3075
Immunocytochemistry SOX9 Antibody [Unconjugated]
Western Blot SOX9 Antibody [Unconjugated]
Immunocytochemistry SOX9 Antibody [Unconjugated]
(2 Reviews)
(154 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
POMC Antibody
NB100-1533
Flow Cytometry POMC Antibody
Immunohistochemistry POMC Antibody
Immunohistochemistry POMC Antibody
(10 Publications)
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
ACAD8 Antibody
NBP2-47559
Western Blot ACAD8 Antibody
Immunohistochemistry-Paraffin ACAD8 Antibody
Immunohistochemistry-Paraffin ACAD8 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
iNOS Antibody -
BSA Free
NB300-605
Western Blot iNOS Antibody - BSA Free
Western Blot iNOS Antibody - BSA Free
Western Blot iNOS Antibody - BSA Free
(3 Reviews)
(130 Publications)
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
LRH-1/NR5A2
Antibody
NBP2-27196
Immunohistochemistry-Paraffin LRH-1/NR5A2 Antibody
Western Blot LRH-1/NR5A2 Antibody
(1 Publication)
Species: Bv, Ca, Ch, ChHa, Eq, Gp, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, RM, Ze
Applications: IHC, IHC-P, KD, WB
COX-2 Antibody
NB100-689
Immunohistochemistry-Paraffin COX-2 Antibody
Simple Western COX-2 Antibody
(1 Review)
(36 Publications)
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
StAR Antibody
NBP1-33485
Western Blot StAR Antibody
Western Blot StAR Antibody
Immunohistochemistry-Paraffin StAR Antibody
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
WT1 Antibody
(6F-H2) - BSA Free
NB110-60011
Western Blot WT1 Antibody (6F-H2) - BSA Free
Immunohistochemistry-Paraffin WT1 Antibody (6F-H2) - BSA Free
Western Blot WT1 Antibody (6F-H2) - BSA Free
(3 Reviews)
(16 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Glycerol Kinase
Antibody (8S4T8)
NBP3-15687
Immunohistochemistry-Paraffin Glycerol Kinase Antibody (8S4T8)
Immunohistochemistry-Paraffin Glycerol Kinase Antibody (8S4T8)
Western Blot Glycerol Kinase Antibody (8S4T8)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Collagen II
Antibody (5B2.5) - BS
NB600-844
Immunohistochemistry-Paraffin Collagen II Antibody (5B2.5) - BSA Free
Immunohistochemistry-Paraffin Collagen II Antibody (5B2.5) - BSA Free
Western Blot Collagen II Antibody (5B2.5) - BSA Free
(50 Publications)
Species: Ch, Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Androgen R/NR3C4
[p Ser213, p Ser210] ...
NB100-56603
Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free
(14 Publications)
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
TLR4 Antibody
(76B357.1) - BSA Free
NB100-56566
Dual RNAscope ISH-IHC TLR4 Antibody (76B357.1) - BSA Free
Immunohistochemistry TLR4 Antibody (76B357.1) - BSA Free
Immunohistochemistry TLR4 Antibody (76B357.1) - BSA Free
(5 Reviews)
(141 Publications)
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, WB
DAX1/NR0B1
Recombinant Protein A
NBP2-68781PEP
DAX1/NR0B1 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for DAX1/NR0B1 Recombinant Protein Antigen (NBP2-68781PEP) (0)

There are no publications for DAX1/NR0B1 Recombinant Protein Antigen (NBP2-68781PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DAX1/NR0B1 Recombinant Protein Antigen (NBP2-68781PEP) (0)

There are no reviews for DAX1/NR0B1 Recombinant Protein Antigen (NBP2-68781PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DAX1/NR0B1 Recombinant Protein Antigen (NBP2-68781PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DAX1/NR0B1 Products

Research Areas for DAX1/NR0B1 Recombinant Protein Antigen (NBP2-68781PEP)

Find related products by research area.

Blogs on DAX1/NR0B1

There are no specific blogs for DAX1/NR0B1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DAX1/NR0B1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol NR0B1