![Immunohistochemistry-Paraffin: Cytochrome P450 2E1 Antibody [NBP1-85367] - Analysis in human liver and endometrium tissues. Corresponding CYP2E1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Cytochrome-P450-2E1-Antibody-Immunohistochemistry-Paraffin-NBP1-85367-img0019.jpg "Immunohistochemistry-Paraffin: Cytochrome P450 2E1 Antibody [NBP1-85367] - Analysis in human liver and endometrium tissues. Corresponding CYP2E1 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, Rt, V-ViSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EKLHEEIDRVIGPSRIPAIKDRQEMPYMDAVVHEIQRFITLVPSNLPHEATRDTIFRGYLIPKGTVVVPTLDSVLYDNQEFPDPEKFKPEHFLNENGKFKYSDYFKPFSTGKRVCAG |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CYP2E1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
reviewed by:
Armen Petrosyan |
WB | Human | 11/10/2024 |
Summary
|
|||||||||||
|
reviewed by:
Armen Petrosyan |
WB | Rat | 11/09/2024 |
Summary
|
|||||||||||
|
reviewed by:
Armen Petrosyan |
Immunocytochemistry/Immunofluorescence | Human | 11/06/2024 |
Summary
Comments
|
|||||||||||
|
reviewed by:
Armen Petrosyan |
WB | Mouse | 11/06/2024 |
Summary
|
|||||||||||
Enlarge |
reviewed by:
Marta Melis |
IHC-P | Mouse | 12/21/2019 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for Cytochrome P450 2E1 Antibody (NBP1-85367)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| Armen Petrosyan 11/10/2024 |
||
| Application: | WB | |
| Species: | Human |
| Armen Petrosyan 11/09/2024 |
||
| Application: | WB | |
| Species: | Rat |
| Armen Petrosyan 11/06/2024 |
||
| Application: | Immunocytochemistry/Immunofluorescence | |
| Species: | Human |
| Gene Symbol | CYP2E1 |
![Immunohistochemistry-Paraffin: Cytochrome P450 2E1 Antibody [NBP1-85367] - Staining of human endometrium, liver, liver cancer and tonsil using Anti-CYP2E1 antibody NBP1-85367 (A) shows similar protein distribution across tissues to independent antibody NBP1-85366 (B).](http://images.novusbio.com/fullsize/Cytochrome-P450-2E1-Antibody-Immunohistochemistry-Paraffin-NBP1-85367-img0018.jpg "Immunohistochemistry-Paraffin: Cytochrome P450 2E1 Antibody [NBP1-85367] - Staining of human endometrium, liver, liver cancer and tonsil using Anti-CYP2E1 antibody NBP1-85367 (A) shows similar protein distribution across tissues to independent antibody NBP1-85366 (B).")
![Western Blot: Cytochrome P450 2E1 Antibody [NBP1-85367] - Western blot analysis in mouse liver tissue and rat liver tissue.](http://images.novusbio.com/fullsize/Cytochrome-P450-2E1-Antibody-Western-Blot-NBP1-85367-img0011.jpg "Western Blot: Cytochrome P450 2E1 Antibody [NBP1-85367] - Western blot analysis in mouse liver tissue and rat liver tissue.")
![Immunohistochemistry-Paraffin: Cytochrome P450 2E1 Antibody [NBP1-85367] - Staining of human endometrium shows no positivity in glandular or stromal cells as expected.](http://images.novusbio.com/fullsize/Cytochrome-P450-2E1-Antibody-Immunohistochemistry-Paraffin-NBP1-85367-img0023.jpg "Immunohistochemistry-Paraffin: Cytochrome P450 2E1 Antibody [NBP1-85367] - Staining of human endometrium shows no positivity in glandular or stromal cells as expected.")
![Western Blot: Cytochrome P450 2E1 Antibody [NBP1-85367] - Analysis in human liver tissue.](http://images.novusbio.com/fullsize/Cytochrome-P450-2E1-Antibody-Western-Blot-NBP1-85367-img0009.jpg "Western Blot: Cytochrome P450 2E1 Antibody [NBP1-85367] - Analysis in human liver tissue.")
![Immunohistochemistry-Paraffin: Cytochrome P450 2E1 Antibody [NBP1-85367] - Staining of human liver cancer shows moderate cytoplasmic positivity in tumor cells.](http://images.novusbio.com/fullsize/Cytochrome-P450-2E1-Antibody-Immunohistochemistry-Paraffin-NBP1-85367-img0020.jpg "Immunohistochemistry-Paraffin: Cytochrome P450 2E1 Antibody [NBP1-85367] - Staining of human liver cancer shows moderate cytoplasmic positivity in tumor cells.")
![Immunohistochemistry-Paraffin: Cytochrome P450 2E1 Antibody [NBP1-85367] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/Cytochrome-P450-2E1-Antibody-Immunohistochemistry-Paraffin-NBP1-85367-img0022.jpg "Immunohistochemistry-Paraffin: Cytochrome P450 2E1 Antibody [NBP1-85367] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: Cytochrome P450 2E1 Antibody [NBP1-85367] - Staining of human tonsil shows no positivity in germinal center cells as expected.](http://images.novusbio.com/fullsize/Cytochrome-P450-2E1-Antibody-Immunohistochemistry-Paraffin-NBP1-85367-img0021.jpg "Immunohistochemistry-Paraffin: Cytochrome P450 2E1 Antibody [NBP1-85367] - Staining of human tonsil shows no positivity in germinal center cells as expected.")
![Western Blot: Rabbit Polyclonal Cytochrome P450 2E1 Antibody [NBP1-85367] - Western Blot of the liver homogenates from control and alcohol-fed mice. Image from a verified customer review.](http://images.novusbio.com/fullsize/antibody/nbp1-85367_rabbit-polyclonal-cytochrome-p450-2e1-antibody-western-blot-1111202492220..png "Western Blot: Rabbit Polyclonal Cytochrome P450 2E1 Antibody [NBP1-85367] - Western Blot of the liver homogenates from control and alcohol-fed mice. Image from a verified customer review.")
![Western Blot: Rabbit Polyclonal Cytochrome P450 2E1 Antibody [NBP1-85367] - Cytochrome P450 2E1 western blot of the homogenates from control and alcohol-fed rats. Image from a verified customer review.](http://images.novusbio.com/fullsize/antibody/nbp1-85367_rabbit-polyclonal-cytochrome-p450-2e1-antibody-western-blot-1111202494054..png "Western Blot: Rabbit Polyclonal Cytochrome P450 2E1 Antibody [NBP1-85367] - Cytochrome P450 2E1 western blot of the homogenates from control and alcohol-fed rats. Image from a verified customer review.")
![Western Blot: Rabbit Polyclonal Cytochrome P450 2E1 Antibody [NBP1-85367] - Cytochrome P450 2E1 western blot of the lysate of VL-17A cells (Hep G2 cells that stably express both Cytochrome P450 2E1 and ADH): control and treated with EtOH. Image from a verified customer review.](http://images.novusbio.com/fullsize/antibody/nbp1-85367_rabbit-polyclonal-cytochrome-p450-2e1-antibody-western-blot-1111202494617..png "Western Blot: Rabbit Polyclonal Cytochrome P450 2E1 Antibody [NBP1-85367] - Cytochrome P450 2E1 western blot of the lysate of VL-17A cells (Hep G2 cells that stably express both Cytochrome P450 2E1 and ADH): control and treated with EtOH. Image from a verified customer review.")
![Immunocytochemistry/Immunofluorescence: Rabbit Polyclonal Cytochrome P450 2E1 Antibody [NBP1-85367] - VA-13 cells (mouse ADH1-transfected HepG2 cells) stained with Cytochrome P450 2E1 Antibody. Image from a verified customer review.](http://images.novusbio.com/fullsize/antibody/nbp1-85367_rabbit-polyclonal-cytochrome-p450-2e1-antibody-immunocytochemistry-immunofluorescence-2611202414201..png "Immunocytochemistry/Immunofluorescence: Rabbit Polyclonal Cytochrome P450 2E1 Antibody [NBP1-85367] - VA-13 cells (mouse ADH1-transfected HepG2 cells) stained with Cytochrome P450 2E1 Antibody. Image from a verified customer review.")
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
