![Western Blot: CTNNA3 Antibody (8F1U7) [NBP3-15741] - Western blot analysis of lysates from Rat brain, using CTNNA3 Rabbit mAb at 1 : 1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 3s.](http://images.novusbio.com/fullsize/nbp3-15741_rabbit-ctnna3-mab-8f1u7-822025209855.jpg "Western Blot: CTNNA3 Antibody (8F1U7) [NBP3-15741] - Western blot analysis of lysates from Rat brain, using CTNNA3 Rabbit mAb at 1 : 1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 3s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clone | 8F1U7 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 700-895 of human CTNNA3 (Q9UI47). DIIVLAKNMCMIMMEMTDFTRGKGPLKHTTDVIYAAKMISESGSRMDVLARQIANQCPDPSCKQDLLAYLEQIKFYSHQLKICSQVKAEIQNLGGELIMSALDSVTSLIQAAKNLMNAVVQTVKMSYIASTKIIRIQSPAGPRHPVVMWRMKAPAKKPLIKREKPEETCAAVRRGSAKKKIHPLQVMSEFRGRQIY |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | CTNNA3 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_15885.jpg)
![Immunohistochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunohistochemistry_15886.jpg)
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_16572.jpg)
![Western Blot beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Western_Blot_5100.jpg)
![Chromatin Immunoprecipitation (ChIP) beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Chromatin_Immunoprecipitation_11251.jpg)
![Simple Western beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/betaCatenin_AF1329_Simple_Western_17134.jpg)
![Immunohistochemistry LRRTM3 Antibody [Unconjugated]](https://images.novusbio.com/images2/LRRTM3_AF4898_Immunohistochemistry_10290.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CTNNA3 |
![Immunohistochemistry: CTNNA3 Antibody (8F1U7) [NBP3-15741] - Immunohistochemistry analysis of CTNNA3 in paraffin-embedded human breast cancer tissue using CTNNA3 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-15741_rabbit-ctnna3-mab-8f1u7-8220252010469.jpg "Immunohistochemistry: CTNNA3 Antibody (8F1U7) [NBP3-15741] - Immunohistochemistry analysis of CTNNA3 in paraffin-embedded human breast cancer tissue using CTNNA3 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: CTNNA3 Antibody (8F1U7) [NBP3-15741] - Immunohistochemistry analysis of CTNNA3 in paraffin-embedded human stomach tissue using CTNNA3 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-15741_rabbit-ctnna3-mab-8f1u7-8220252010448.jpg "Immunohistochemistry: CTNNA3 Antibody (8F1U7) [NBP3-15741] - Immunohistochemistry analysis of CTNNA3 in paraffin-embedded human stomach tissue using CTNNA3 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Western Blot: CTNNA3 Antibody (8F1U7) [NBP3-15741] - Western blot analysis of various lysates, using CTNNA3 Rabbit mAb at 1 : 1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 10s.](http://images.novusbio.com/fullsize/nbp3-15741_rabbit-ctnna3-mab-8f1u7-822025208440.jpg "Western Blot: CTNNA3 Antibody (8F1U7) [NBP3-15741] - Western blot analysis of various lysates, using CTNNA3 Rabbit mAb at 1 : 1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 10s.")
![Immunohistochemistry: CTNNA3 Antibody (8F1U7) [NBP3-15741] - Immunohistochemistry analysis of CTNNA3 in paraffin-embedded human colon tissue using CTNNA3 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-15741_rabbit-ctnna3-mab-8f1u7-8220252010476.jpg "Immunohistochemistry: CTNNA3 Antibody (8F1U7) [NBP3-15741] - Immunohistochemistry analysis of CTNNA3 in paraffin-embedded human colon tissue using CTNNA3 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: CTNNA3 Antibody (8F1U7) [NBP3-15741] - Immunohistochemistry analysis of CTNNA3 in paraffin-embedded mouse heart tissue using CTNNA3 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-15741_rabbit-ctnna3-mab-8f1u7-822025208457.jpg "Immunohistochemistry: CTNNA3 Antibody (8F1U7) [NBP3-15741] - Immunohistochemistry analysis of CTNNA3 in paraffin-embedded mouse heart tissue using CTNNA3 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Simple Western Vinculin Antibody (728526) [Unconjugated]](https://images.novusbio.com/images2/Vinculin_MAB6896_Simple_Western_16408.jpg)
![Western Blot Vinculin Antibody (728526) [Unconjugated]](https://images.novusbio.com/images2/Vinculin_MAB6896_Western_Blot_11566.jpg)
![Immunohistochemistry Vinculin Antibody (728526) [Unconjugated]](https://images.novusbio.com/images2/Vinculin_MAB6896_Immunohistochemistry_11621.jpg)
![Enzyme Activity u-Plasminogen Activator/Urokinase [Unconjugated]](https://images.novusbio.com/images2/uPlasminogen_Activator_1310SE_1837.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")