Home » COPE » COPE Antibodies » COPE Antibody
Novus Biologicals products are now on bio-techne.com

COPE Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: COPE Antibody [NBP2-38488] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & the Golgi apparatus.
Immunocytochemistry/ Immunofluorescence: COPE Antibody [NBP2-38488] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & the Golgi apparatus.
Immunohistochemistry: COPE Antibody [NBP2-38488] - Staining of human stomach, upper shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

COPE Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: DATLTQLATAWVSLATGGEKLQDAYYIFQEMADKCSPTLLLLNGQAACHMAQGRWEAAEGLLQEALDKDSGYPETLVNL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
COPE
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
COPE Protein (NBP2-38488PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for COPE Antibody

  • coatomer epsilon subunit
  • coatomer protein complex, subunit epsilon
  • coatomer subunit epsilon
  • epsilon coat protein
  • Epsilon-coat protein
  • epsilon-COP
  • FLJ13241

Background

The product of this gene is an epsilon subunit of coatomer protein complex. Coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles. It is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins. Coatomer complex consists of at least the alpha, beta, beta', gamma, delta, epsilon and zeta subunits. Alternatively spliced transcript variants encoding different isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

COPZ1 Antibody -
Azide and BSA Free
NBP2-92058
Western Blot COPZ1 Antibody - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence COPZ1 Antibody - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence COPZ1 Antibody - Azide and BSA Free
Species: Hu, Mu
Applications: ICC/IF, WB
alpha COP I
Antibody
NBP1-89705
Immunohistochemistry-Paraffin alpha COP I Antibody
Immunohistochemistry-Paraffin alpha COP I Antibody
Immunohistochemistry-Paraffin alpha COP I Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
COPG Antibody
NBP2-55178
Western Blot COPG Antibody
Immunocytochemistry/ Immunofluorescence COPG Antibody
Immunohistochemistry-Paraffin COPG Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Thymidylate
Synthase Antibody (HL ...
NBP3-25721
Western Blot Thymidylate Synthase Antibody (HL1236) - Azide and BSA Free
Western Blot Thymidylate Synthase Antibody (HL1236) - Azide and BSA Free
Immunohistochemistry-Paraffin Thymidylate Synthase Antibody (HL1236) - Azide and BSA Free
Species: Ca, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
RHCE Antibody
NBP3-17923
Immunohistochemistry-Paraffin RHCE Antibody
Species: Hu
Applications: IHC, IHC-P
RHD Antibody
NBP2-84247
Western Blot RHD Antibody
Western Blot RHD Antibody
Western Blot RHD Antibody
Species: Hu
Applications: WB
Thromboxane
synthase Antibody (OT
NBP2-02710
Flow Cytometry Thromboxane synthase Antibody (OTI2C1)
Flow Cytometry Thromboxane synthase Antibody (OTI2C1)
Flow Cytometry Thromboxane synthase Antibody (OTI2C1)
(1 Publication)
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Cav1.2 Antibody
(S57)
NBP1-22439
Immunocytochemistry/ Immunofluorescence Cav1.2 Antibody (S57)
Western Blot Cav1.2 Antibody (S57)
Immunohistochemistry Cav1.2 Antibody (S57)
(3 Publications)
Species: Ha, Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
COP Antibody
NB100-856
Immunocytochemistry/ Immunofluorescence COP Antibody
Flow Cytometry COP Antibody
(1 Publication)
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA
CRAT Antibody
NBP1-86616
Western Blot CRAT Antibody
Western Blot CRAT Antibody
Immunohistochemistry-Paraffin CRAT Antibody
(2 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
WIRE Antibody
NBP1-86856
Western Blot WIRE Antibody
Immunohistochemistry-Paraffin WIRE Antibody
Immunohistochemistry-Paraffin WIRE Antibody
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
GLYAT Antibody
NBP2-58917
Western Blot GLYAT Antibody
Immunohistochemistry-Paraffin GLYAT Antibody
Immunohistochemistry-Paraffin GLYAT Antibody
Species: Hu
Applications: IHC, IHC-P, WB
NDUFB6 Antibody
NBP1-92172
Immunohistochemistry-Paraffin NDUFB6 Antibody
Western Blot NDUFB6 Antibody
Immunocytochemistry/ Immunofluorescence NDUFB6 Antibody
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Catalase Antibody
[Unconjugated]
AF3398
Western Blot Catalase Antibody [Unconjugated]
Simple Western Catalase Antibody [Unconjugated]
Knockout Validated Catalase Antibody [Unconjugated]
(3 Reviews)
(15 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Corneodesmosin
Antibody [Unconjugate
AF5725
Immunohistochemistry Corneodesmosin Antibody [Unconjugated]
(3 Publications)
Species: Hu
Applications: IHC
Adenine Nucleotide
Translocator 2 Antibo ...
NBP2-92630
Immunocytochemistry/ Immunofluorescence Adenine Nucleotide Translocator 2 Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin Adenine Nucleotide Translocator 2 Antibody - Azide and BSA Free
Western Blot Adenine Nucleotide Translocator 2 Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Annexin A2
Antibody (1G7)
H00000302-M02
Immunocytochemistry/ Immunofluorescence Annexin A2 Antibody (1G7)
Immunocytochemistry/ Immunofluorescence Annexin A2 Antibody (1G7)
Western Blot Annexin A2 Antibody (1G7)
(1 Review)
(7 Publications)
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IP, WB
Kallikrein 3/PSA
[HRP]
DKK300
N/A Kallikrein 3/PSA [HRP]
N/A Kallikrein 3/PSA [HRP]
N/A Kallikrein 3/PSA [HRP]
(17 Publications)
Species: Hu
Applications: ELISA
beta COP Antibody
NBP2-15578
Western Blot beta COP Antibody
Immunohistochemistry-Paraffin beta COP Antibody
Immunocytochemistry/ Immunofluorescence beta COP Antibody
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Recombinant Human
RHAG GST (N-Term) Pro ...
H00006005-P01
Other Recombinant Human RHAG GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, WB

Publications for COPE Antibody (NBP2-38488) (0)

There are no publications for COPE Antibody (NBP2-38488).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COPE Antibody (NBP2-38488) (0)

There are no reviews for COPE Antibody (NBP2-38488). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for COPE Antibody (NBP2-38488) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional COPE Products

Research Areas for COPE Antibody (NBP2-38488)

Find related products by research area.

Blogs on COPE

There are no specific blogs for COPE, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our COPE Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol COPE
Uniprot