![Immunohistochemistry-Paraffin: Complement C5 Antibody [NBP1-84395] - Staining of human lung shows moderate cytoplasmic positivity in macrophages.](http://images.novusbio.com/fullsize/Complement-C5-Antibody-Immunohistochemistry-Paraffin-NBP1-84395-img0007.jpg "Immunohistochemistry-Paraffin: Complement C5 Antibody [NBP1-84395] - Staining of human lung shows moderate cytoplasmic positivity in macrophages.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LLVKQLRLSMDIDVSYKHKGALHNYKMTDKNFLGRPVEVLLNDDLIVSTGFGSGLATVHVTTVVHKTSTSEEVCSFYLKIDTQDIEASHYRGYGNSDYKRIVACASYKPSREESSSGSSHAVMDISLPTGI |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | C5 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Complement C5 Antibody (NBP1-84395)Find related products by research area.
|
|
Complement C3 - The Most Important Protein in the Complement System The complement system is made up of a collection of proteins found in the bloodstream and is comprised of nine major complement proteins; complement C3 is one of them. The complement system is a crucial component of the cellular immune system becau... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | C5 |
![Immunohistochemistry-Paraffin: Complement C5 Antibody [NBP1-84395] - Staining of human small intestine shows moderate cytoplasmic positivity in lymphoid cells.](http://images.novusbio.com/fullsize/Complement-C5-Antibody-Immunohistochemistry-Paraffin-NBP1-84395-img0005.jpg "Immunohistochemistry-Paraffin: Complement C5 Antibody [NBP1-84395] - Staining of human small intestine shows moderate cytoplasmic positivity in lymphoid cells.")
![Immunohistochemistry-Paraffin: Complement C5 Antibody [NBP1-84395] - Staining of human lymph node shows moderate cytoplasmic positivity in lymphoid cells.](http://images.novusbio.com/fullsize/Complement-C5-Antibody-Immunohistochemistry-Paraffin-NBP1-84395-img0006.jpg "Immunohistochemistry-Paraffin: Complement C5 Antibody [NBP1-84395] - Staining of human lymph node shows moderate cytoplasmic positivity in lymphoid cells.")
![Immunohistochemistry-Paraffin: Complement C5 Antibody [NBP1-84395] - Staining of human placenta shows moderate positivity in plasma.](http://images.novusbio.com/fullsize/Complement-C5-Antibody-Immunohistochemistry-Paraffin-NBP1-84395-img0008.jpg "Immunohistochemistry-Paraffin: Complement C5 Antibody [NBP1-84395] - Staining of human placenta shows moderate positivity in plasma.")
![Neutralization Complement Component C5aR1 Antibody (347214) [Unconjugated]](https://images.novusbio.com/images2/Complement_Component_C5a_R1_MAB3648_Block_Neutralize_9166.jpg)
![N/A CXCL10/IP-10/CRG-2 [HRP]](https://images.novusbio.com/images2/DATA_CXCL10_DIP100_ELISA_723.jpg)
![N/A CXCL10/IP-10/CRG-2 [HRP]](https://images.novusbio.com/images2/DATA_CXCL10_DIP100_ELISA_724.jpg)
![N/A CXCL10/IP-10/CRG-2 [HRP]](https://images.novusbio.com/images2/CXCL10_DIP100_ELISA_121.jpg)
![Simple Western Aldo-keto Reductase 1C1/AKR1C1 Antibody (859026) [Unconjugated]](https://images.novusbio.com/images2/Aldoketo_Reductase_1C1_MAB6529_Simple_Western_17147.jpg)
![Western Blot Aldo-keto Reductase 1C1/AKR1C1 Antibody (859026) [Unconjugated]](https://images.novusbio.com/images2/Aldoketo_Reductase_1C1_MAB6529_Western_Blot_13068.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Immunohistochemistry Complement Factor H Antibody [Unconjugated]](https://images.novusbio.com/images2/Complement_Factor_H_AF4779_Immunohistochemistry_7182.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")