Novus Biologicals products are now on bio-techne.com

Collagen V alpha 2 Antibody (3G11)

Name: Collagen V alpha 2 Antibody (3G11)
Brand: Novus Biologicals
SKU: H00001290-M02
Price: 519 USD

Submit a Review

Images

(

Enlarge)

Immunocytochemistry/ Immunofluorescence: Collagen V alpha 2 Antibody (3G11) [H00001290-M02] - Analysis of monoclonal antibody to COL5A2 on HeLa cell . Antibody concentration 10 ug/ml.

ELISA: Collagen V alpha 2 Antibody (3G11) [H00001290-M02] - Detection limit for recombinant GST tagged COL5A2 is 0.03 ng/ml as a capture antibody.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	WB, ELISA, ICC/IF
Clone	3G11
Clonality	Monoclonal
Host	Mouse
Conjugate	Unconjugated

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Collagen V alpha 2 Antibody (3G11) Summary

Description	Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen	COL5A2 (NP_000384, 41 a.a. ~ 124 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. CTQNGQMYLNRDIWKPAPCQICVCDNGAILCDKIECQDVLDCADPVTPPGECCPVCSQTPGGGNTNFGRGRKGQKGEPGLVPVV
Specificity	This product is specific for Human COL5A2 monoclonal antibody (M02), clone 3G11 [Gene ID: 1290].
Isotype	IgG2a Kappa
Clonality	Monoclonal
Host	Mouse
Gene	COL5A2
Purity	IgG purified
Innovator's Reward	Test in a species/application not listed above to receive a full credit towards a future purchase. Learn about the Innovator's Reward

Applications/Dilutions

Dilutions

ELISA
Immunocytochemistry/ Immunofluorescence
Western Blot

Packaging, Storage & Formulations

Storage	Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer	In 1x PBS, pH 7.4
Preservative	No Preservative
Purity	IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Collagen V alpha 2 Antibody (3G11)

AB collagen
collagen alpha-2(V) chain
collagen, fetal membrane, A polypeptide
collagen, type V, alpha 2
MGC105115
type V preprocollagen alpha 2 chain

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Collagen III alpha
1/COL3A1 Antibody

NB600-594

Western Blot Collagen III alpha 1/COL3A1 Antibody

(7 Reviews)

(49 Publications)

Species: Bv, Fe, Hu, Mu, Rt, Sh

Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB

Collagen V
Antibody (1E2-E4/Col5 ...

NBP1-05118

(2 Publications)

Species: Bv, Ca, Ch(-), Gp(-), Hu, Ma, Mu(-), Po, Rb, Rt(-), Sh

Applications: ELISA, IHC, IHC-Fr, IHC-P, WB

Collagen I Antibody

NB600-408

(16 Reviews)

(322 Publications)

Species: Bv, Hu, Mu, Po, Rb, Rt

Applications: ELISA, FLISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, MiAr, PAGE, WB

COL1A2 Antibody -
Azide and BSA Free

NBP2-92790

Immunocytochemistry/ Immunofluorescence COL1A2 Antibody - Azide and BSA Free

(1 Publication)

Species: Hu, Mu, Rt

Applications: ELISA, ICC/IF, IHC, IHC-P, WB

Fibronectin
Antibody - BSA Free

NBP1-91258

(11 Reviews)

(56 Publications)

Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt

Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB

Decorin Antibody
[Unconjugated]

AF143

Simple Western Decorin Antibody [Unconjugated]

Immunohistochemistry Decorin Antibody [Unconjugated]

(29 Publications)

Species: Hu

Applications: IHC, Simple Western, WB

COL11A1 Antibody -
BSA Free

NBP3-04904

Western Blot COL11A1 Antibody - BSA Free

Species: Hu, Mu, Rt

Applications: ELISA, IHC, IHC-P, WB

Collagen II
Antibody (5B2.5) - BS

NB600-844

Western Blot Collagen II Antibody (5B2.5) - BSA Free

(50 Publications)

Species: Ch, Hu, Mu, Rb, Rt

Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB

Collagen IV
Antibody

NB120-6586

(7 Reviews)

(42 Publications)

Species: Bv, Fe, Hu, Mu, Rt

Applications: ELISA, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, KO, SR Microscopy, WB

Human Collagen VI
alpha 3 ELISA Kit (Co ...

NBP2-75880

Species: Hu

Applications: ELISA

Fibrillin 1
Antibody

NBP1-84722

(4 Publications)

Species: Hu

Applications: ICC/IF, IHC, IHC-P

HOXB1 Antibody

AF6318

Species: Hu

Applications: ICC

Tenascin X
Antibody [Unconjugate

AF6999

Immunohistochemistry Tenascin X Antibody [Unconjugated]

Simple Western Tenascin X Antibody [Unconjugated]

(1 Publication)

Species: Hu

Applications: IHC, Simple Western, WB

E2F-4 Antibody

NBP1-21374

Immunohistochemistry-Paraffin E2F-4 Antibody

(2 Publications)

Species: Hu

Applications: IHC, IHC-P, IP, KD, WB

Thrombospondin-2
[Unconjugated]

1635-T2

(10 Publications)

Species: Hu

Applications: BA

CENPE Antibody

NBP1-82875

Immunohistochemistry-Paraffin CENPE Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P

Bcl-2 Antibody

NB100-56098

(2 Reviews)

(26 Publications)

Species: Ca, Hu, Mu, Rt

Applications: IHC, IHC-P, IP, WB

BMP-1/PCP Antibody
[Unconjugated]

AF1927

(10 Publications)

Species: Hu

Applications: IP, WB

Pax5/BSAP Antibody
(1207C) [Unconjugated ...

MAB3487

Western Blot Pax5/BSAP Antibody (1207C) [Unconjugated]

Immunohistochemistry Pax5/BSAP Antibody (1207C) [Unconjugated]

(1 Publication)

Species: Hu, Mu

Applications: Flow, ICC, IHC, Simple Western, WB

Collagen VI alpha
1 Antibody

NB120-6588

Immunohistochemistry-Frozen Collagen VI alpha 1 Antibody

Flow Cytometry Collagen VI alpha 1 Antibody

(1 Review)

(19 Publications)

Species: Bv, Fe, Hu, Mu, Rt

Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PCR, WB

Publications for Collagen V alpha 2 Antibody (H00001290-M02) (0)

There are no publications for Collagen V alpha 2 Antibody (H00001290-M02).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Collagen V alpha 2 Antibody (H00001290-M02) (0)

There are no reviews for Collagen V alpha 2 Antibody (H00001290-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

ICC/IF Video Protocol

FAQs for Collagen V alpha 2 Antibody (H00001290-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

Isotype Controls

Additional Collagen V alpha 2 Products

Blogs on Collagen V alpha 2

There are no specific blogs for Collagen V alpha 2, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Western blot shows detection of Mouse Anti-Human/Mouse/Rat STAT3 Monoclonal Antibody (MAB1799) using a 1:1000 dilution of HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.

Goat anti-Mouse IgG Secondary Antibody [HRP]
HAF007

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Review this Product

Be the first to review our Collagen V alpha 2 Antibody (3G11) and receive a gift card or discount.

Bioinformatics

Gene Symbol	COL5A2
Uniprot	NP_000384(Human)

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Collagen V alpha 2 Antibody (3G11)

Species Glossary

Images

Product Details

Order Details

Collagen V alpha 2 Antibody (3G11) Summary

Applications/Dilutions

Packaging, Storage & Formulations

Notes

Alternate Names for Collagen V alpha 2 Antibody (3G11)

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for Collagen V alpha 2 Antibody (H00001290-M02) (0)

Reviews for Collagen V alpha 2 Antibody (H00001290-M02) (0)

Product General Protocols

Video Protocols

FAQs for Collagen V alpha 2 Antibody (H00001290-M02) (0)

Secondary Antibodies

Isotype Controls

Additional Collagen V alpha 2 Products

Blogs on Collagen V alpha 2

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics