Home » COG8 » COG8 Proteins » COG8 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

COG8 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for COG8 Protein (NBP2-13853PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

COG8 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human COG8.

Source: E. coli

Amino Acid Sequence: AFANYKTFIRGAECTERIHRLFGDVEASLGRLLDRLPSFQQSCRNFVKEAEEISSNRRMNSLTLNRHTEILEILEIPQLMD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
COG8
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13853.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for COG8 Recombinant Protein Antigen

  • COG complex subunit 8
  • component of oligomeric golgi complex 8CDG2H
  • conserved oligomeric Golgi complex subunit 8
  • dependent on RIC1
  • DOR1conserved oligomeric golgi complex component 8
  • FLJ22315

Background

COG8 encodes a protein that is a component of the conserved oligomeric Golgi (COG) complex, a multiprotein complex that plays a structural role in the Golgi apparatus, and is involved in intracellular membrane trafficking and glycoprotein modification. Mutations in this gene cause congenital disorder of glycosylation, type IIh, a disease that is characterized by under-glycosylated serum proteins, and whose symptoms include severe psychomotor retardation, failure to thrive, seizures, and dairy and wheat product intolerance. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

mu Opioid R/OPRM1
Antibody
NBP1-31180
Immunohistochemistry-Paraffin mu Opioid R/OPRM1 Antibody
Western Blot mu Opioid R/OPRM1 Antibody
Immunocytochemistry/ Immunofluorescence mu Opioid R/OPRM1 Antibody
(1 Review)
(5 Publications)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MDH2 Antibody
NBP1-32259
Western Blot MDH2 Antibody
Western Blot MDH2 Antibody
Immunohistochemistry-Paraffin MDH2 Antibody
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
COG1 Antibody -
Azide and BSA Free
NBP3-15543
Immunohistochemistry-Paraffin COG1 Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin COG1 Antibody - Azide and BSA Free
Western Blot COG1 Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
COG2 Antibody
NBP3-38235
Immunohistochemistry COG2 Antibody
Immunohistochemistry COG2 Antibody
Western Blot COG2 Antibody
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
COG3 Antibody
NBP2-15937
Western Blot COG3 Antibody
Western Blot COG3 Antibody
Immunohistochemistry-Paraffin COG3 Antibody
Species: Hu, Mu
Applications: IHC, IHC-P, WB
COP9 Antibody
NBP1-85435
Immunohistochemistry-Paraffin COP9 Antibody
Western Blot COP9 Antibody
Western Blot COP9 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
COG4 Antibody
NBP2-30718
Immunohistochemistry-Paraffin COG4 Antibody
Immunocytochemistry/ Immunofluorescence COG4 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
COG7 Antibody
NBP1-05032
Western Blot COG7 Antibody
Immunohistochemistry-Paraffin COG7 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
POMC Antibody
NB100-1533
Flow Cytometry POMC Antibody
Immunohistochemistry POMC Antibody
Immunohistochemistry POMC Antibody
(10 Publications)
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
COG5 Antibody
NBP1-93713
Immunocytochemistry/ Immunofluorescence COG5 Antibody
Immunohistochemistry-Paraffin COG5 Antibody
Immunohistochemistry-Paraffin COG5 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
PAG1 Antibody
(504004) [Unconjugate
MAB5285
Simple Western PAG1 Antibody (504004) [Unconjugated]
Western Blot PAG1 Antibody (504004) [Unconjugated]
(1 Publication)
Species: Hu
Applications: Simple Western, WB
PYK2/FAK2 [p
Tyr402] Antibody (592 ...
MAB6210
Simple Western PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]
Western Blot PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]
(1 Review)
(1 Publication)
Species: Hu
Applications: Simple Western, WB
GDF-15 [HRP]
DGD150
N/A GDF-15 [HRP]
N/A GDF-15 [HRP]
N/A GDF-15 [HRP]
(99 Publications)
Species: Hu
Applications: ELISA
PFDN1 Antibody
NBP1-87294
Immunocytochemistry/ Immunofluorescence PFDN1 Antibody
Immunohistochemistry-Paraffin PFDN1 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Peroxiredoxin 1
Antibody
NBP1-82558
Immunohistochemistry-Paraffin Peroxiredoxin 1 Antibody
Immunohistochemistry-Paraffin Peroxiredoxin 1 Antibody
Immunohistochemistry-Paraffin Peroxiredoxin 1 Antibody
(8 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
PDF Antibody
(OTI3F3) - Azide and ...
NBP2-73301
Western Blot PDF Antibody (OTI3F3) - Azide and BSA Free
Flow Cytometry PDF Antibody (OTI3F3) - Azide and BSA Free
Flow Cytometry PDF Antibody (OTI3F3) - Azide and BSA Free
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, WB
BBS9 Antibody
NBP1-88927
Immunohistochemistry-Paraffin BBS9 Antibody
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Opsin 1 (Long
Wave) Antibody
NBP3-09392
Western Blot Opsin 1 (Long Wave) Antibody
Species: Hu, Mu
Applications: WB
COG8 Recombinant
Protein Antigen
NBP2-13853PEP
COG8 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for COG8 Protein (NBP2-13853PEP) (0)

There are no publications for COG8 Protein (NBP2-13853PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COG8 Protein (NBP2-13853PEP) (0)

There are no reviews for COG8 Protein (NBP2-13853PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for COG8 Protein (NBP2-13853PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional COG8 Products

Blogs on COG8

There are no specific blogs for COG8, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our COG8 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol COG8