Home » COCO/DAND5 » COCO/DAND5 Proteins » COCO/DAND5 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

COCO/DAND5 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for COCO/DAND5 Protein (NBP2-13899PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

COCO/DAND5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DAND5.

Source: E. coli

Amino Acid Sequence: GMCKAVPFVQVFSRPGCSAIRLRNHLCFGHCSSLYIPGSDPTPLVLCNSCMPARKRWAPVVLWCLTGSSASRRRVKISTMLIEGCHCSPKA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DAND5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13899.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for COCO/DAND5 Recombinant Protein Antigen

  • CER2CRL2
  • Cerberus 2
  • Cerberus like-2
  • cerberus-like 2
  • Cerberus-like protein 2
  • CERL2
  • cerl-2
  • CKTSF1B3
  • CKTSF1B3MGC126849
  • COCO
  • Cysteine knot superfamily 1, BMP antagonist 3
  • DAN domain family member 5
  • DAN domain family, member 5
  • DAND5
  • Dante
  • DTE
  • FLJ38607
  • GREM3
  • GREM3cerberus 2
  • gremlin-3
  • SP1

Background

DAND5, also known as DAN domain family member 5, is a 20 kDa 189 amino acid protein that forms homodimers and heterodimers as a member of the BMP antagonist family. Current research involving the protein includes connections with syrigoma, myopia, norrie disease, astigmatism, and carcinoma. The protein also plays important roles in tissue growth and differentiation pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Sp3 Antibody
AF4256
Western Blot Sp3 Antibody
Species: Hu
Applications: WB
c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin p21/CIP1/CDKN1A Antibody (WA-1)
(24 Publications)
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
c-Fos Antibody
(2H2)
NBP2-50037
Western Blot c-Fos Antibody (2H2)
Immunocytochemistry/ Immunofluorescence c-Fos Antibody (2H2)
Immunocytochemistry/ Immunofluorescence c-Fos Antibody (2H2)
(1 Review)
(20 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
EGR1 Antibody
[Unconjugated]
AF2818
Immunocytochemistry EGR1 Antibody [Unconjugated]
(13 Publications)
Species: Hu
Applications: ICC, WB
NFkB p105/p50
Antibody (2J10D7) - B ...
NB100-56583
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
(1 Review)
(5 Publications)
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
TFF2 Antibody
(366508) [Unconjugate
MAB4077
Immunohistochemistry TFF2 Antibody (366508) [Unconjugated]
(2 Publications)
Species: Hu
Applications: IHC, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(820 Publications)
Species: Hu
Applications: BA
FosB/G0S3 Antibody
[Unconjugated]
AF2214
Immunocytochemistry FosB/G0S3 Antibody [Unconjugated]
Immunohistochemistry FosB/G0S3 Antibody [Unconjugated]
Species: Hu
Applications: ICC, IHC, WB
JunD Antibody
(2D5A1)
NBP3-16602
Immunohistochemistry-Paraffin JunD Antibody (2D5A1)
Immunohistochemistry-Paraffin JunD Antibody (2D5A1)
Immunohistochemistry-Paraffin JunD Antibody (2D5A1)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
JunB/AP-1 Antibody
NBP1-89544
Immunocytochemistry/ Immunofluorescence JunB/AP-1 Antibody
Immunohistochemistry-Paraffin JunB/AP-1 Antibody
Immunohistochemistry-Paraffin JunB/AP-1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
VEGF [HRP]
DVE00
N/A VEGF [HRP]
N/A VEGF [HRP]
N/A VEGF [HRP]
(685 Publications)
Species: Hu
Applications: ELISA
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(42 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Catalase Antibody
[Unconjugated]
AF3398
Western Blot Catalase Antibody [Unconjugated]
Simple Western Catalase Antibody [Unconjugated]
Knockout Validated Catalase Antibody [Unconjugated]
(3 Reviews)
(15 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
CRAT Antibody
NBP1-86616
Western Blot CRAT Antibody
Western Blot CRAT Antibody
Immunohistochemistry-Paraffin CRAT Antibody
(2 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
GLYAT Antibody
NBP2-58917
Western Blot GLYAT Antibody
Immunohistochemistry-Paraffin GLYAT Antibody
Immunohistochemistry-Paraffin GLYAT Antibody
Species: Hu
Applications: IHC, IHC-P, WB
AP2 alpha Antibody
(3B5)
NB100-74359
Western Blot AP2 alpha Antibody (3B5)
Immunohistochemistry-Frozen AP2 alpha Antibody (3B5)
Western Blot AP2 alpha Antibody (3B5)
(1 Review)
(3 Publications)
Species: Ch, Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
TCEAL1 Antibody
(OTI2G10)
NBP2-46085
Immunohistochemistry TCEAL1 Antibody (OTI2G10)
Immunohistochemistry TCEAL1 Antibody (OTI2G10)
Immunohistochemistry TCEAL1 Antibody (OTI2G10)
Species: Hu
Applications: IHC, IHC-P, WB
COCO/DAND5
Recombinant Protein A
NBP2-13899PEP
COCO/DAND5 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for COCO/DAND5 Protein (NBP2-13899PEP) (0)

There are no publications for COCO/DAND5 Protein (NBP2-13899PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COCO/DAND5 Protein (NBP2-13899PEP) (0)

There are no reviews for COCO/DAND5 Protein (NBP2-13899PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for COCO/DAND5 Protein (NBP2-13899PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional COCO/DAND5 Products

Blogs on COCO/DAND5

There are no specific blogs for COCO/DAND5, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
p53 Antibody (PAb 240) - BSA Free
NB200-103

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our COCO/DAND5 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol DAND5