![Immunohistochemistry-Paraffin: CLPTM1L Antibody [NBP1-84378] - Analysis in human testis and skeletal muscle tissues. Corresponding CLPTM1L RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/CLPTM1L-Antibody-Immunohistochemistry-Paraffin-NBP1-84378-img0006.jpg "Immunohistochemistry-Paraffin: CLPTM1L Antibody [NBP1-84378] - Analysis in human testis and skeletal muscle tissues. Corresponding CLPTM1L RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LNVEDFDVESKFERTVNVSVPKKTRNNGTLYAYIFLHHAGVLPWHDGKQVHLVSPLTTYMVPKPEEINLLTGESDTQQIEAEKKPTSALDEPVSHWRPRLALNVMADNFVFDGSSLPADVHRYMKMIQLGKTVHYL |
| Predicted Species | Mouse (91%), Rat (93%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CLPTM1L |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | IHC, ICC/IF reported in scientific literature (PMID: 24648346). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for CLPTM1L Antibody (NBP1-84378)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CLPTM1L |
![Immunocytochemistry/Immunofluorescence: CLPTM1L Antibody [NBP1-84378] - Immunofluorescent staining of human cell line U-251 MG shows localization to endoplasmic reticulum. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/CLPTM1L-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84378-img0005.jpg "Immunocytochemistry/Immunofluorescence: CLPTM1L Antibody [NBP1-84378] - Immunofluorescent staining of human cell line U-251 MG shows localization to endoplasmic reticulum. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: CLPTM1L Antibody [NBP1-84378] - Staining of human tonsil shows strong cytoplasmic postivity in non-germinal center cells.](http://images.novusbio.com/fullsize/CLPTM1L-Antibody-Immunohistochemistry-Paraffin-NBP1-84378-img0011.jpg "Immunohistochemistry-Paraffin: CLPTM1L Antibody [NBP1-84378] - Staining of human tonsil shows strong cytoplasmic postivity in non-germinal center cells.")
![Immunohistochemistry-Paraffin: CLPTM1L Antibody [NBP1-84378] - Staining of human duodenum shows strong cytoplasmic positivity in lymphoid cells.](http://images.novusbio.com/fullsize/CLPTM1L-Antibody-Immunohistochemistry-Paraffin-NBP1-84378-img0007.jpg "Immunohistochemistry-Paraffin: CLPTM1L Antibody [NBP1-84378] - Staining of human duodenum shows strong cytoplasmic positivity in lymphoid cells.")
![Immunohistochemistry-Paraffin: CLPTM1L Antibody [NBP1-84378] - Staining of human lung cancer, adenocarcinoma shows strong positivity.](http://images.novusbio.com/fullsize/CLPTM1L-Antibody-Immunohistochemistry-Paraffin-NBP1-84378-img0008.jpg "Immunohistochemistry-Paraffin: CLPTM1L Antibody [NBP1-84378] - Staining of human lung cancer, adenocarcinoma shows strong positivity.")
![Immunohistochemistry-Paraffin: CLPTM1L Antibody [NBP1-84378] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/CLPTM1L-Antibody-Immunohistochemistry-Paraffin-NBP1-84378-img0009.jpg "Immunohistochemistry-Paraffin: CLPTM1L Antibody [NBP1-84378] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: CLPTM1L Antibody [NBP1-84378] - Staining of human skeletal muscle shows no postivity in myocytes as expected.](http://images.novusbio.com/fullsize/CLPTM1L-Antibody-Immunohistochemistry-Paraffin-NBP1-84378-img0010.jpg "Immunohistochemistry-Paraffin: CLPTM1L Antibody [NBP1-84378] - Staining of human skeletal muscle shows no postivity in myocytes as expected.")
![Immunohistochemistry: CLPTM1L Antibody [NBP1-84378] - Representative Immunohistochemical staining according to Cleft Lip & Palate Transmembrane 1-Like (Clptm1L) & TMEM207 immunoreactivity at the invasion front of oral squamous cell carcinoma (OSCC). Weak Clptm1L or TMEM207 immunoreactivity was found in non-tumorous oral epithelial cells (A,B), respectively. In contrast, Clptm1L or TMEM207 immunoreactivity was found in many invasive OSCC cells. Representative positive Clptm1L immunoreactivity in tissue specimens from patients with favorable & poor prognosis is shown in (C,D), respectively. TMEM207 immunoreactivity in tissue specimens from patients with favorable & poor prognosis is shown in (E,F), respectively. Note the robust Clptm1L & TMEM207 immunoreactivity in (D,F). Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/35047994), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-84378_rabbit-polyclonal-clptm1l-antibody-310202415175292.jpg "Immunohistochemistry: CLPTM1L Antibody [NBP1-84378] - Representative Immunohistochemical staining according to Cleft Lip & Palate Transmembrane 1-Like (Clptm1L) & TMEM207 immunoreactivity at the invasion front of oral squamous cell carcinoma (OSCC). Weak Clptm1L or TMEM207 immunoreactivity was found in non-tumorous oral epithelial cells (A,B), respectively. In contrast, Clptm1L or TMEM207 immunoreactivity was found in many invasive OSCC cells. Representative positive Clptm1L immunoreactivity in tissue specimens from patients with favorable & poor prognosis is shown in (C,D), respectively. TMEM207 immunoreactivity in tissue specimens from patients with favorable & poor prognosis is shown in (E,F), respectively. Note the robust Clptm1L & TMEM207 immunoreactivity in (D,F). Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/35047994), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunocytochemistry Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Immunocytochemistry__Immunofluorescence_20674.jpg)
![Immunohistochemistry Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Immunohistochemistry_20779.jpg)
![Western Blot Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Western_Blot_5715.jpg)
![Western Blot BAK Antibody [Unconjugated]](https://images.novusbio.com/images2/BAK_AF816_Western_Blot_5904.jpg)
![Immunocytochemistry BAK Antibody [Unconjugated]](https://images.novusbio.com/images2/BAK_AF816_Immunocytochemistry__Immunofluorescence_22091.jpg)
![Immunohistochemistry BAK Antibody [Unconjugated]](https://images.novusbio.com/images/af816_human-bak-affinity-purified-polyclonal-ab-immunohistochemistry-26420239384.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")