Home » CLIP170 » CLIP170 Proteins » CLIP170 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

CLIP170 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for CLIP170 Protein (NBP1-85568PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

CLIP170 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CLIP1.

Source: E. coli

Amino Acid Sequence: KNLELQLKENKRQLSSSSGNTDTQADEDERAQESQIDFLNSVIVDLQRKNQDLKMKVEMMSEAALNGNGDDLNNYDSDDQEKQSKKKPRLFCDICDCFDLHDTEDCPTQAQMSEDPPHSTHHGSRGEERPYCEICEMFGHWATNCNDDET

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CLIP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85568.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CLIP170 Recombinant Protein Antigen

  • CAP-GLY domain containing linker protein 1
  • CLIP
  • CLIP170
  • CLIP-170Reed-Sternberg intermediate filament-associated protein
  • CYLN1MGC131604
  • cytoplasmic linker 1
  • Cytoplasmic linker protein 1
  • Cytoplasmic linker protein 170 alpha-2
  • Reed-Steinberg cell-expressed intermediate filament-associated protein
  • restin (Reed-Steinberg cell-expressed intermediate filament-associated protein)
  • Restin
  • RSNCAP-Gly domain-containing linker protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

POMC Antibody
NB100-1533
Flow Cytometry POMC Antibody
Immunohistochemistry POMC Antibody
Immunohistochemistry POMC Antibody
(10 Publications)
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Renin Antibody
(411507) - Propeptide
MAB4447
Immunohistochemistry Renin Antibody (411507) - Propeptide
(6 Publications)
Species: Hu
Applications: IHC, WB
Serpin
A8/Angiotensinogen An ...
NBP1-30027
Immunohistochemistry-Paraffin Serpin A8/Angiotensinogen Antibody - BSA Free
Western Blot Serpin A8/Angiotensinogen Antibody - BSA Free
Immunohistochemistry-Paraffin Serpin A8/Angiotensinogen Antibody - BSA Free
(11 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
ACE/CD143 Antibody
[Unconjugated]
AF1513
Immunohistochemistry ACE/CD143 Antibody [Unconjugated]
Western Blot ACE/CD143 Antibody [Unconjugated]
Simple Western ACE/CD143 Antibody [Unconjugated]
(1 Review)
(7 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
MAPRE1 Antibody
NBP1-84928
Western Blot MAPRE1 Antibody
Western Blot MAPRE1 Antibody
Immunohistochemistry-Paraffin MAPRE1 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
DMPK Antibody
(713931)
MAB6967
Western Blot DMPK Antibody (713931)
Species: Hu
Applications: WB
EB2 Antibody
(OTI1F3)
NBP2-00714
Flow Cytometry EB2 Antibody (OTI1F3)
Flow Cytometry EB2 Antibody (OTI1F3)
Flow Cytometry EB2 Antibody (OTI1F3)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(818 Publications)
Species: Hu
Applications: BA
ANKS1B Antibody
NBP3-17099
Immunohistochemistry-Paraffin ANKS1B Antibody
Immunohistochemistry-Paraffin ANKS1B Antibody
Immunohistochemistry-Paraffin ANKS1B Antibody
Species: Hu
Applications: IHC, IHC-P
COX7A2L Antibody
H00009167-B02P
Western Blot COX7A2L Antibody
Western Blot COX7A2L Antibody
Western Blot COX7A2L Antibody
Species: Hu
Applications: WB

alpha-Fetoprotein/AFP ...
MAB1368
Simple Western alpha-Fetoprotein/AFP Antibody (189502) [Unconjugated]
Knockout Validated alpha-Fetoprotein/AFP Antibody (189502) [Unconjugated]
Knockout Validated alpha-Fetoprotein/AFP Antibody (189502) [Unconjugated]
(3 Reviews)
(91 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, KO, Simple Western, WB
WIRE Antibody
NBP1-86856
Western Blot WIRE Antibody
Immunohistochemistry-Paraffin WIRE Antibody
Immunohistochemistry-Paraffin WIRE Antibody
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Angiogenin [HRP]
DAN00
N/A Angiogenin [HRP]
N/A Angiogenin [HRP]
(23 Publications)
Species: Hu
Applications: ELISA
IQGAP1 Antibody
(2C5)
H00008826-M01
Western Blot IQGAP1 Antibody (2C5)
Western Blot IQGAP1 Antibody (2C5)
Western Blot IQGAP1 Antibody (2C5)
(5 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, S-ELISA, WB
Catalase Antibody
[Unconjugated]
AF3398
Western Blot Catalase Antibody [Unconjugated]
Simple Western Catalase Antibody [Unconjugated]
Knockout Validated Catalase Antibody [Unconjugated]
(3 Reviews)
(15 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
CYLN2 Antibody
NBP1-85569
Immunohistochemistry-Paraffin CYLN2 Antibody
Immunohistochemistry-Paraffin CYLN2 Antibody
Immunohistochemistry-Paraffin CYLN2 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB

Myeloperoxidase/MPO An ...
AF3667
Western Blot Myeloperoxidase/MPO Antibody [Unconjugated]
Simple Western Myeloperoxidase/MPO Antibody [Unconjugated]
Immunocytochemistry Myeloperoxidase/MPO Antibody [Unconjugated]
(3 Reviews)
(167 Publications)
Species: Hu, Mu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB
CLIP170
Recombinant Protein A
NBP1-85568PEP
CLIP170 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for CLIP170 Protein (NBP1-85568PEP) (0)

There are no publications for CLIP170 Protein (NBP1-85568PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CLIP170 Protein (NBP1-85568PEP) (0)

There are no reviews for CLIP170 Protein (NBP1-85568PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CLIP170 Protein (NBP1-85568PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CLIP170 Products

Array NBP1-85568PEP

Research Areas for CLIP170 Protein (NBP1-85568PEP)

Find related products by research area.

Blogs on CLIP170

There are no specific blogs for CLIP170, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Western blot shows lysates of HL-60 human acute promyelocytic leukemia cell line, human neutrophil cells, and mouse spleen tissue. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse Myeloperoxidase/MPO Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3667) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (HAF019). A specific band was detected for Myeloperoxidase/MPO at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 2.
Myeloperoxidase/MPO Antibody [Unconjugated]
AF3667

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CLIP170 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol CLIP1