![Western Blot: CLEC10A/CD301 Antibody [NBP1-84591] - Analysis in control (vector only transfected HEK293T lysate) and CLEC10A over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/CLEC10A-CD301-Antibody-Western-Blot-NBP1-84591-img0005.jpg "Western Blot: CLEC10A/CD301 Antibody [NBP1-84591] - Analysis in control (vector only transfected HEK293T lysate) and CLEC10A over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: CPVNWVEHQDSCYWFSHSGMSWAEAEKYCQLKNAHLVVINSREEQNFVQKYLGSAYTWMGLSDPEGAWKWVDGTDYATGFQNWKPGQPDDWQGHGLGGGEDCAHFHPDGRWND |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CLEC10A |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-84591 | Applications | Species |
|---|---|---|
| Yao S, Zhou Z, Wang L et al. Targeting endometrial inflammation in intrauterine adhesion ameliorates endometrial fibrosis by priming MSCs to secrete C1INH iScience 2023-06-01 [PMID: 37456855] |
Secondary Antibodies |
Isotype Controls |
Research Areas for CLEC10A/CD301 Antibody (NBP1-84591)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: CLEC10A/CD301 Antibody [NBP1-84591] - Staining of human testis shows mocerate to strong cytoplasmic postivity in Leydig cells.](http://images.novusbio.com/fullsize/CLEC10A-CD301-Antibody-Immunohistochemistry-Paraffin-NBP1-84591-img0009.jpg "Immunohistochemistry-Paraffin: CLEC10A/CD301 Antibody [NBP1-84591] - Staining of human testis shows mocerate to strong cytoplasmic postivity in Leydig cells.")
![Immunohistochemistry-Paraffin: CLEC10A/CD301 Antibody [NBP1-84591] - Staining of human lymph node shows moderate to strong membranous positivity in non-germinal center cells.](http://images.novusbio.com/fullsize/CLEC10A-CD301-Antibody-Immunohistochemistry-Paraffin-NBP1-84591-img0006.jpg "Immunohistochemistry-Paraffin: CLEC10A/CD301 Antibody [NBP1-84591] - Staining of human lymph node shows moderate to strong membranous positivity in non-germinal center cells.")
![Immunohistochemistry-Paraffin: CLEC10A/CD301 Antibody [NBP1-84591] - Staining of human small intestine shows moderate to strong membranous positivity in lymphoid cells.](http://images.novusbio.com/fullsize/CLEC10A-CD301-Antibody-Immunohistochemistry-Paraffin-NBP1-84591-img0007.jpg "Immunohistochemistry-Paraffin: CLEC10A/CD301 Antibody [NBP1-84591] - Staining of human small intestine shows moderate to strong membranous positivity in lymphoid cells.")
![Immunohistochemistry-Paraffin: CLEC10A/CD301 Antibody [NBP1-84591] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.](http://images.novusbio.com/fullsize/CLEC10A-CD301-Antibody-Immunohistochemistry-Paraffin-NBP1-84591-img0008.jpg "Immunohistochemistry-Paraffin: CLEC10A/CD301 Antibody [NBP1-84591] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.")
![Western Blot Rap1A/B Antibody [Unconjugated]](https://images.novusbio.com/images2/Rap1B_AF3767_Western_Blot_5331.jpg)
![Western Blot Rap1A/B Antibody [Unconjugated]](https://images.novusbio.com/images2/Rap1B_AF3767_Western_Blot_6316.jpg)
![Immunohistochemistry Rap1A/B Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af3767_human-mouse-rat-rap1a-b-affinity-purified-polyclonal-ab-immunohistochemistry-318202392533..jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Immunohistochemistry Lipoprotein Lipase/LPL Antibody [Unconjugated]](https://images.novusbio.com/images2/Lipoprotein_Lipase_AF7197_Immunohistochemistry_21186.jpg)
![Western Blot Lipoprotein Lipase/LPL Antibody [Unconjugated]](https://images.novusbio.com/images2/Lipoprotein_Lipase_AF7197_Western_Blot_11656.jpg)
![Immunocytochemistry Lipoprotein Lipase/LPL Antibody [Unconjugated]](https://images.novusbio.com/images2/Lipoprotein_Lipase_AF7197_Immunocytochemistry_11911.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")