![Western Blot: CLCN3 Antibody [NBP2-87193] - Host: Rabbit. Target Name: CLCN3. Sample Tissue: Human 293T. Antibody Dilution: 1.0ug/ml](http://images.novusbio.com/fullsize/CLCN3-Antibody-Western-Blot-NBP2-87193-img0002.jpg "Western Blot: CLCN3 Antibody [NBP2-87193] - Host: Rabbit. Target Name: CLCN3. Sample Tissue: Human 293T. Antibody Dilution: 1.0ug/ml")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 1 mg/ml |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of human CLCN3. Peptide sequence: VGDAFGREGIYEAHIRLNGYPFLDAKEEFTHTTLAADVMRPRRNDPPLAVL The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CLCN3 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 1 mg/ml |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for CLCN3 Antibody (NBP2-87193)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CLCN3 |
![Immunohistochemistry: CLCN3 Antibody [NBP2-87193] - Human Brain](http://images.novusbio.com/fullsize/CLCN3-Antibody-Immunohistochemistry-NBP2-87193-img0001.jpg "Immunohistochemistry: CLCN3 Antibody [NBP2-87193] - Human Brain")
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_6973.jpg)
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_9671.jpg)
![Immunoprecipitation CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images/mab25031_human-cftr-c-terminus-mab-clone-24-1-41202412513815.jpg)
![Western Blot Galectin-10 Antibody [Unconjugated]](https://images.novusbio.com/images2/Galectin-10_AF5447_Western_Blot_5721.jpg)
![Intracellular Staining by Flow Cytometry Galectin-10 Antibody [Unconjugated]](https://images.novusbio.com/images2/Galectin-10_AF5447_Flow_Cytometry_8273.jpg)
![Intracellular Staining by Flow Cytometry Galectin-10 Antibody [Unconjugated]](https://images.novusbio.com/images2/af5447_human-galectin-10-affinity-purified-polyclonal-ab-flow-cytometry-2162021133613.jpg)
![Immunohistochemistry CLC Antibody (138815) [Unconjugated]](https://images.novusbio.com/images2/CLC_MAB962_Immunohistochemistry_17289.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![N/A IL-13 [Biotin]](https://images.novusbio.com/images2/DATA_IL13_DY413_ELISA_2010.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")