![Immunocytochemistry/Immunofluorescence: CLCN6 Antibody (2H2) [H00001185-M05] - Analysis of monoclonal antibody to CLCN6 on HeLa cell. Antibody concentration 10 ug/ml](http://images.novusbio.com/fullsize/CLCN6-Antibody-2H2-Immunocytochemistry-Immunofluorescence-H00001185-M05-img0002.jpg "Immunocytochemistry/Immunofluorescence: CLCN6 Antibody (2H2) [H00001185-M05] - Analysis of monoclonal antibody to CLCN6 on HeLa cell. Antibody concentration 10 ug/ml")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, ICC/IF |
| Clone | 2H2 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | CLCN6 (NP_001277.1, 770 a.a. ~ 868 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PRLSYAEMAEDYPRYPDIHDLDLTLLNPRMIVDVTPYMNPSPFTVSPNTHVSQVFNLFRTMGLRHLPVVNAVGEIVGIITRHNLTYEFLQARLRQHYQT |
| Specificity | CLCN6 - chloride channel 6 (2H2) |
| Isotype | IgG2b Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | CLCN6 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for CLCN6 Antibody (H00001185-M05)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![ELISA: CLCN6 Antibody (2H2) [H00001185-M05] - Detection limit for recombinant GST tagged CLCN6 is 1 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/CLCN6-Antibody-2H2-ELISA-H00001185-M05-img0003.jpg "ELISA: CLCN6 Antibody (2H2) [H00001185-M05] - Detection limit for recombinant GST tagged CLCN6 is 1 ng/ml as a capture antibody.")
![Western Blot Galectin-10 Antibody [Unconjugated]](https://images.novusbio.com/images2/Galectin-10_AF5447_Western_Blot_5721.jpg)
![Intracellular Staining by Flow Cytometry Galectin-10 Antibody [Unconjugated]](https://images.novusbio.com/images2/Galectin-10_AF5447_Flow_Cytometry_8273.jpg)
![Intracellular Staining by Flow Cytometry Galectin-10 Antibody [Unconjugated]](https://images.novusbio.com/images2/af5447_human-galectin-10-affinity-purified-polyclonal-ab-flow-cytometry-2162021133613.jpg)
![Immunohistochemistry CLC Antibody (138815) [Unconjugated]](https://images.novusbio.com/images2/CLC_MAB962_Immunohistochemistry_17289.jpg)
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_6973.jpg)
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_9671.jpg)
![Immunoprecipitation CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images/mab25031_human-cftr-c-terminus-mab-clone-24-1-41202412513815.jpg)
