Home » Cip4 » Cip4 Proteins » Cip4 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Cip4 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Cip4 Recombinant Protein Antigen (NBP2-68940PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Cip4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Cip4.

Source: E. coli

Amino Acid Sequence: QIAETLSNIERLKLEVQKYEAWLAEAESRVLSNRGDSLSRHARPPDPPASAPPDSSSNSASQDTKESSEE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TRIP10
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-68940.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Cip4 Recombinant Protein Antigen

  • cdc42-interacting protein 4
  • CIP4STOT
  • HSTP
  • Protein Felic
  • Salt tolerant protein
  • salt tolerator
  • STPTRIP-10
  • thyroid hormone receptor interactor 10
  • thyroid receptor interacting protein 10
  • Thyroid receptor-interacting protein 10
  • TR-interacting protein 10

Background

TRIP10/CIP4 is a multi-functional adapter protein and plays a role in the translocation of Glut4 (glucose transporter) vesicles to the cell surface in response to insulin. TRIP10/CIP4 has also been found to interact with the active GTPases CDC42 and TC10 as well as the Wiskott-Aldrich syndrome protein (WASP), a protein involved in cytoskeletal organization. Recent studies suggest that CIP4 accumulation may play a role in Huntington's disease pathogenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

FNBP1 Antibody
NBP2-48542
Immunohistochemistry-Paraffin FNBP1 Antibody
Immunohistochemistry-Paraffin FNBP1 Antibody
Western Blot FNBP1 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
Carbonic Anhydrase
I/CA1 Antibody
NBP1-88191
Western Blot Carbonic Anhydrase I/CA1 Antibody
Immunohistochemistry-Paraffin Carbonic Anhydrase I/CA1 Antibody
Immunohistochemistry-Paraffin Carbonic Anhydrase I/CA1 Antibody
(3 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western Blot Src [p Tyr419] Antibody [Unconjugated]
Simple Western Src [p Tyr419] Antibody [Unconjugated]
Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]
(1 Review)
(10 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
FNBP1L Antibody -
BSA Free
NBP1-76845
Immunocytochemistry/ Immunofluorescence FNBP1L Antibody - BSA Free
Immunohistochemistry FNBP1L Antibody - BSA Free
Western Blot FNBP1L Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
CDC42 Antibody
(JJ086-04)
NBP2-67895
Flow Cytometry CDC42 Antibody (JJ086-04)
Immunohistochemistry-Paraffin CDC42 Antibody (JJ086-04)
Immunohistochemistry-Paraffin CDC42 Antibody (JJ086-04)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
WASP Antibody
NB300-996
Immunohistochemistry-Paraffin WASP Antibody
Immunocytochemistry/ Immunofluorescence WASP Antibody
Immunocytochemistry/ Immunofluorescence WASP Antibody
(1 Publication)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Fes Antibody
(678527)
MAB6460
Immunohistochemistry Fes Antibody (678527)
Western Blot Fes Antibody (678527)
Species: Hu
Applications: IHC, WB
PRRT2 Antibody -
BSA Free
NBP2-82026
Western Blot PRRT2 Antibody - BSA Free
Immunohistochemistry PRRT2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence PRRT2 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Glut4 Antibody -
BSA Free
NBP1-49533
Flow (Intracellular) Glut4 Antibody - BSA Free
Western Blot Glut4 Antibody - BSA Free
Western Blot Glut4 Antibody - BSA Free
(4 Reviews)
(41 Publications)
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
Fer Antibody - BSA
Free
NBP1-20089
Knockdown Validated Fer Antibody - BSA Free
Western Blot Fer Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Fer Antibody - BSA Free
Species: Hu
Applications: ICC/IF, KD, WB
N-WASP Antibody
NBP1-82512
Immunocytochemistry/ Immunofluorescence N-WASP Antibody
Immunohistochemistry-Paraffin N-WASP Antibody
Immunohistochemistry-Paraffin N-WASP Antibody
(7 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
CD46 Antibody
(344519) [Unconjugate
MAB2005
N/A CD46 Antibody (344519) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, WB
TC10 Antibody
(10F7Y7)
NBP3-15915
Immunohistochemistry-Paraffin TC10 Antibody (10F7Y7)
Western Blot TC10 Antibody (10F7Y7)
Western Blot TC10 Antibody (10F7Y7)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Complement C4b/d
Antibody (16D2)
NB200-541
Western Blot Complement C4b/d Antibody (16D2)
(12 Publications)
Species: Mu
Applications: IA, ICC/IF, IHC, IHC-Fr, IP, WB
DBT Antibody
NBP1-89522
Immunocytochemistry/ Immunofluorescence DBT Antibody
Immunohistochemistry-Paraffin DBT Antibody
Immunohistochemistry-Paraffin DBT Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Western Blot HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
Cip4 Recombinant
Protein Antigen
NBP2-68940PEP
Cip4 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Cip4 Recombinant Protein Antigen (NBP2-68940PEP) (0)

There are no publications for Cip4 Recombinant Protein Antigen (NBP2-68940PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cip4 Recombinant Protein Antigen (NBP2-68940PEP) (0)

There are no reviews for Cip4 Recombinant Protein Antigen (NBP2-68940PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Cip4 Recombinant Protein Antigen (NBP2-68940PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Cip4 Products

Research Areas for Cip4 Recombinant Protein Antigen (NBP2-68940PEP)

Find related products by research area.

Blogs on Cip4

There are no specific blogs for Cip4, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Flow (Intracellular): Glut4 Antibody [NBP1-49533] - An intracellular stain was performed on HepG2 with NBP1-49533 and a matched isotype control. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature, followed by Rabbit IgG (H+L) Cross-Adsorbed Secondary Antibody.
Glut4 Antibody - BSA Free
NBP1-49533
Flow Cytometry: NOD2 Antibody (2D9) [NB100-524] - An intracellular stain was performed on Jurkat cells with NOD2 (2D9) antibody NB100-524APC (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes.
NOD2 Antibody (2D9) - BSA Free
NB100-524

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Cip4 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol TRIP10