![Western Blot: CHD1L Antibody [NBP1-89153] - Analysis using Anti-CHD1L antibody NBP1-89153 (A) shows similar pattern to independent antibody NBP1-89154 (B).](http://images.novusbio.com/fullsize/CHD1L-Antibody-Western-Blot-NBP1-89153-img0012.jpg "Western Blot: CHD1L Antibody [NBP1-89153] - Analysis using Anti-CHD1L antibody NBP1-89153 (A) shows similar pattern to independent antibody NBP1-89154 (B).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GSRDQEEGKNHMYLFEGKDYSKEPSKEDRKSFEQLVNLQKTLLEKASQEGRSLRNKGSVLIPGLVEGSTKRKRVLSPEELEDRQKKRQEAAAKRRRLIEEKKR |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CHD1L |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 [Unconjugated]")
| Publication using NBP1-89153 | Applications | Species |
|---|---|---|
| Brockschmidt A, Chung B, Weber S et al. CHD1L: a new candidate gene for congenital anomalies of the kidneys and urinary tract (CAKUT). Nephrol Dial Transplant 2012-06-01 [PMID: 22146311] |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CHD1L |
![Immunocytochemistry/Immunofluorescence: CHD1L Antibody [NBP1-89153] - Staining of human cell line U-2 OS shows localization to nucleoplasm.](http://images.novusbio.com/fullsize/CHD1L-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89153-img0010.jpg "Immunocytochemistry/Immunofluorescence: CHD1L Antibody [NBP1-89153] - Staining of human cell line U-2 OS shows localization to nucleoplasm.")
![Immunohistochemistry-Paraffin: CHD1L Antibody [NBP1-89153] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/CHD1L-Antibody-Immunohistochemistry-Paraffin-NBP1-89153-img0020.jpg "Immunohistochemistry-Paraffin: CHD1L Antibody [NBP1-89153] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: CHD1L Antibody [NBP1-89153] - Staining of human cerebral cortex shows strong nuclear positivity in neurons.](http://images.novusbio.com/fullsize/CHD1L-Antibody-Immunohistochemistry-Paraffin-NBP1-89153-img0017.jpg "Immunohistochemistry-Paraffin: CHD1L Antibody [NBP1-89153] - Staining of human cerebral cortex shows strong nuclear positivity in neurons.")
![Immunohistochemistry-Paraffin: CHD1L Antibody [NBP1-89153] - Staining of human skin shows strong nuclear positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize/CHD1L-Antibody-Immunohistochemistry-Paraffin-NBP1-89153-img0019.jpg "Immunohistochemistry-Paraffin: CHD1L Antibody [NBP1-89153] - Staining of human skin shows strong nuclear positivity in squamous epithelial cells.")
![Western Blot Brg1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Brg1_AF5738_Western_Blot_5829.jpg)
![Immunocytochemistry Brg1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Brg1_AF5738_Immunocytochemistry_11663.jpg)
![Immunocytochemistry Brg1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Brg1_AF5738_Immunocytochemistry_11664.jpg)
![Immunohistochemistry DCC Antibody [Unconjugated]](https://images.novusbio.com/images2/af844_mouse-dcc-affinity-purified-polyclonal-ab-immunohistochemistry-21102022151713.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")