![Western Blot: Cdx1 Antibody (2D8) [H00001044-M01] - CDX1 monoclonal antibody (M01), clone 2D8. Analysis of CDX1 expression in human lung cancer.](http://images.novusbio.com/fullsize/Cdx1-Antibody-2D8-Western-Blot-H00001044-M01-img0004.jpg "Western Blot: Cdx1 Antibody (2D8) [H00001044-M01] - CDX1 monoclonal antibody (M01), clone 2D8. Analysis of CDX1 expression in human lung cancer.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC |
| Clone | 2D8 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | CDX1 (NP_001795, 126 a.a. ~ 215 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GAQRPTPYEWMRRSVAAGGGGGSGKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKSELAANLGLTERQVKIWFQNRRAKERKVNKK |
| Specificity | CDX1 - caudal type homeobox transcription factor 1 |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | CDX1 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactivity against recombinant protein for WB. It has been used for ELISA. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
![Western Blot beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Western_Blot_5100.jpg)
![Chromatin Immunoprecipitation (ChIP) beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Chromatin_Immunoprecipitation_11251.jpg)
![Simple Western beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/betaCatenin_AF1329_Simple_Western_17134.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Cdx1 Antibody (H00001044-M01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: Cdx1 Antibody (2D8) [H00001044-M01] - Analysis of monoclonal antibody to CDX1 on HeLa cell . Antibody concentration 10 ug/ml.](http://images.novusbio.com/fullsize/Cdx1-Antibody-2D8-Immunocytochemistry-Immunofluorescence-H00001044-M01-img0003.jpg "Immunocytochemistry/Immunofluorescence: Cdx1 Antibody (2D8) [H00001044-M01] - Analysis of monoclonal antibody to CDX1 on HeLa cell . Antibody concentration 10 ug/ml.")
![Immunohistochemistry-Paraffin: Cdx1 Antibody (2D8) [H00001044-M01] - CDX1 ( Cat # H00001044-M01 ) on formalin-fixed paraffin-embedded human stomach. [antibody concentration 0.5 ug/ml]](http://images.novusbio.com/fullsize/Cdx1-Antibody-2D8-Immunohistochemistry-Paraffin-H00001044-M01-img0001.jpg "Immunohistochemistry-Paraffin: Cdx1 Antibody (2D8) [H00001044-M01] - CDX1 ( Cat # H00001044-M01 ) on formalin-fixed paraffin-embedded human stomach. [antibody concentration 0.5 ug/ml]")
![Bioactivity Wnt-3a [Unconjugated]](https://images.novusbio.com/images2/Wnt3a_5036WN_2880.jpg)
![Bioactivity Wnt-3a [Unconjugated]](https://images.novusbio.com/images2/5036-wn_recombinant-human-wnt-3a-protein-bioactivity-3112023115329.jpg)
![Cell Culture Wnt-3a [Unconjugated]](https://images.novusbio.com/images/5036-wn_recombinant-human-wnt-3a-protein-bioactivity-252023103514.jpg)
