Home » CDCA5 » CDCA5 Proteins » CDCA5 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

CDCA5 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for CDCA5 Protein (NBP1-89530PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

CDCA5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CDCA5.

Source: E. coli

Amino Acid Sequence: SILPEIWPKTPSAAAVRKPIVLKRIVAHAVEVPAVQSPRRSPRISFFLEKENEPPGRELTKEDLFKTHSVPATPTSTPVPNPEAESSSKEGELDARDLEMSKKVR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CDCA5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89530.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CDCA5 Recombinant Protein Antigen

  • cell division cycle associated 5
  • Cell division cycle-associated protein 5
  • MGC16386
  • p35
  • SORORIN

Background

Regulator of sister chromatid cohesion in mitosis. May act by regulating the ability of the cohesin complexto mediate sister chromatid cohesion, perhaps by altering the nature of the interaction of cohesin with thechromosomes

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Cdk5 Antibody
NBP2-15843
Western Blot Cdk5 Antibody
Immunohistochemistry-Paraffin Cdk5 Antibody
Immunocytochemistry/ Immunofluorescence Cdk5 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
CDK5 Activator 1
Antibody
NBP3-13279
Immunocytochemistry/ Immunofluorescence CDK5 Activator 1 Antibody
Immunohistochemistry-Paraffin CDK5 Activator 1 Antibody
Immunohistochemistry-Paraffin CDK5 Activator 1 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
p63/TP73L Antibody
[Unconjugated]
AF1916
Immunohistochemistry p63/TP73L Antibody [Unconjugated]
Immunocytochemistry p63/TP73L Antibody [Unconjugated]
Immunocytochemistry/ Immunofluorescence p63/TP73L Antibody [Unconjugated]
(1 Review)
(24 Publications)
Species: Hu
Applications: ICC, IHC, WB
IL-9 [Unconjugated]
409-ML
IL-9 [Unconjugated]
(13 Publications)
Species: Mu
Applications: BA
GEF-H1 Antibody
NBP2-21577
Western Blot GEF-H1 Antibody
Western Blot GEF-H1 Antibody
Western Blot GEF-H1 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, WB
PSMD7 Antibody
NBP2-38780
Immunocytochemistry/ Immunofluorescence PSMD7 Antibody
Immunohistochemistry-Paraffin PSMD7 Antibody
Western Blot PSMD7 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
EBNA1BP2 Antibody
NBP1-84022
Immunocytochemistry/ Immunofluorescence EBNA1BP2 Antibody
Western Blot EBNA1BP2 Antibody
Western Blot EBNA1BP2 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
LANCL1 Antibody
NBP1-81796
Immunocytochemistry/ Immunofluorescence LANCL1 Antibody
Immunohistochemistry-Paraffin LANCL1 Antibody
Immunohistochemistry-Paraffin LANCL1 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
p40 Antibody
NBP1-32956
Immunocytochemistry/ Immunofluorescence p40 Antibody
Immunohistochemistry-Paraffin p40 Antibody
Western Blot p40 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
RPSA Antibody
(RPSA/2699) - Azide a ...
NBP2-79854
Immunohistochemistry-Paraffin RPSA Antibody (RPSA/2699) - Azide and BSA Free
Immunohistochemistry-Paraffin RPSA Antibody (RPSA/2699) - Azide and BSA Free
Immunohistochemistry-Paraffin RPSA Antibody (RPSA/2699) - Azide and BSA Free
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, PA, WB
TPPP/p25 Antibody
NBP2-34031
Western Blot TPPP/p25 Antibody
Immunohistochemistry-Paraffin TPPP/p25 Antibody
Immunohistochemistry-Paraffin TPPP/p25 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
TMED9 Antibody
(A9A8)
NBP3-33026
Western Blot TMED9 Antibody (A9A8)
Immunohistochemistry TMED9 Antibody (A9A8)
Immunocytochemistry/ Immunofluorescence TMED9 Antibody (A9A8)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Lipocalin-2/NGAL
[Biotin]
DY1857
N/A Lipocalin-2/NGAL [Biotin]
(132 Publications)
Species: Mu
Applications: ELISA
IL-23A/IL-23 P19
[Unconjugated]
1290-IL
IL-23A/IL-23 P19 [Unconjugated]
(115 Publications)
Species: Hu
Applications: BA
IFN-gamma
[Unconjugated]
285-IF
Bioactivity IFN-gamma [Unconjugated]
SDS-PAGE IFN-gamma [Unconjugated]
SEC-MALS IFN-gamma [Unconjugated]
(2 Reviews)
(452 Publications)
Species: Hu
Applications: BA
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(811 Publications)
Species: Hu
Applications: BA
Tau Antibody (2E9)
NBP2-25162
Immunocytochemistry/ Immunofluorescence Tau Antibody (2E9)
Western Blot Tau Antibody (2E9)
Immunocytochemistry/ Immunofluorescence Tau Antibody (2E9)
(5 Publications)
Species: Bv, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, PLA, WB
Caspase-3 Antibody
[Unconjugated] - Acti ...
AF835
Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active
Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active
Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active
(7 Reviews)
(388 Publications)
Species: Hu, Mu
Applications: ICC, IHC
c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, Simple Western, WB

Publications for CDCA5 Protein (NBP1-89530PEP) (0)

There are no publications for CDCA5 Protein (NBP1-89530PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDCA5 Protein (NBP1-89530PEP) (0)

There are no reviews for CDCA5 Protein (NBP1-89530PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CDCA5 Protein (NBP1-89530PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CDCA5 Products

Research Areas for CDCA5 Protein (NBP1-89530PEP)

Find related products by research area.

Blogs on CDCA5

There are no specific blogs for CDCA5, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Recombinant Human IFN-gamma (Catalog # 285‑IF) demonstrates anti-viral activity in HeLa human cervical epithelial carcinoma cells infected with encephalomyocarditis (EMC) virus. The activity is over 2-fold greater than the top competitor's IFN-gamma .
IFN-gamma [Unconjugated]
285-IF-100

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CDCA5 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol CDCA5