Home » CD53 » CD53 Proteins » CD53 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

CD53 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for CD53 Protein (NBP2-14464PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

CD53 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD53.

Source: E. coli

Amino Acid Sequence: NEYVAKGLTDSIHRYHSDNSTKAAWDSIQSFLQCCGINGTSDWTSGPPASCPSDRKVEGCYAKARLWFHS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CD53
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-14464.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CD53 Recombinant Protein Antigen

  • antigen MOX44 identified by monoclonal MRC-OX44
  • CD53 antigentetraspanin-25
  • CD53 glycoprotein
  • CD53 molecule
  • CD53 tetraspan antigen
  • CD53
  • cell surface antigen
  • Cell surface glycoprotein CD53
  • MOX44
  • MOX44transmembrane glycoprotein
  • Tetraspanin-25
  • TSPAN25
  • tspan-25
  • TSPAN25leukocyte surface antigen CD53

Background

The antibody reacts with CD53 antigen, a glycoprotein of 32-40 kDa belonging to the tetraspans family (TM4SF). CD53 antigen is exclusivelly expressed on leucocytes (not present on platelets, red blood cells and non-hematopoietic cells). CD53 is important for signal transduction. CD53 cross-linking promotes activation of human B cells and rat macrophages.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Western Blot HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
CD63 Antibody
(H5C6) - BSA Free
NBP2-42225
Immunocytochemistry/ Immunofluorescence CD63 Antibody (H5C6) - BSA Free
Flow (Intracellular) CD63 Antibody (H5C6) - BSA Free
Western Blot CD63 Antibody (H5C6) - BSA Free
(5 Reviews)
(56 Publications)
Species: Ca, Hu
Applications: B/N, DB, EM, ELISA, Flow-IC, Flow, Func, ICC/IF, IHC-WhMt, IP, In vitro, WB
CD9 Antibody
(MEM-61) - BSA Free
NB500-327
Flow Cytometry CD9 Antibody (MEM-61) - BSA Free
Flow Cytometry CD9 Antibody (MEM-61) - BSA Free
Flow Cytometry CD9 Antibody (MEM-61) - BSA Free
(1 Review)
(16 Publications)
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, In vitro, WB
CD82/Kai-1
Antibody (C33) - BSA
NBP2-21792
Flow Cytometry CD82/Kai-1 Antibody (C33) - BSA Free
Immunohistochemistry-Paraffin CD82/Kai-1 Antibody (C33) - BSA Free
Flow Cytometry CD82/Kai-1 Antibody (C33) - BSA Free
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
CD81 Antibody
(1D6) - BSA Free
NB100-65805
Flow Cytometry CD81 Antibody (1D6) - BSA Free
Flow Cytometry CD81 Antibody (1D6) - BSA Free
Western Blot CD81 Antibody (1D6) - BSA Free
(1 Review)
(25 Publications)
Species: Gt, Hu, Mu, Pm, Sh
Applications: CyTOF-ready, DB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB
CD37 Antibody
(2B8) - BSA Free
NBP1-28869
Immunohistochemistry-Paraffin CD37 Antibody (2B8) - BSA Free
Flow Cytometry CD37 Antibody (2B8) - BSA Free
Immunocytochemistry/ Immunofluorescence CD37 Antibody (2B8) - BSA Free
(2 Reviews)
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P
Integrin beta
2/CD18 Antibody [Unco ...
AF1730
Immunocytochemistry Integrin beta 2/CD18 Antibody [Unconjugated]
Immunocytochemistry Integrin beta 2/CD18 Antibody [Unconjugated]
(14 Publications)
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
Integrin alpha
L/CD11a Antibody (345 ...
MAB3595
Western Blot Integrin alpha L/CD11a Antibody (345913) [Unconjugated]
Simple Western Integrin alpha L/CD11a Antibody (345913) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, Simple Western, WB
CD151 Antibody
(455807) [Unconjugate
MAB4609
Flow Cytometry CD151 Antibody (455807) [Unconjugated]
Immunocytochemistry CD151 Antibody (455807) [Unconjugated]
(1 Publication)
Species: Mu
Applications: CyTOF-ready, Flow, ICC
Uroplakin Ib
Antibody
NBP1-80656
Western Blot Uroplakin Ib Antibody
Immunohistochemistry-Paraffin Uroplakin Ib Antibody
Western Blot Uroplakin Ib Antibody
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
CD44 Antibody
(2C5) [Unconjugated] ...
BBA10
Simple Western CD44 Antibody (2C5) [Unconjugated] - s Pan Specific
Western Blot CD44 Antibody (2C5) [Unconjugated] - s Pan Specific
Immunohistochemistry CD44 Antibody (2C5) [Unconjugated] - s Pan Specific
(5 Reviews)
(49 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
ICAM-1/CD54
Antibody [Unconjugate
AF796
Immunohistochemistry ICAM-1/CD54 Antibody [Unconjugated]
Western Blot ICAM-1/CD54 Antibody [Unconjugated]
Western Blot ICAM-1/CD54 Antibody [Unconjugated]
(6 Reviews)
(85 Publications)
Species: Mu
Applications: AdBlk, IHC, WB
Tetraspanin-4
Antibody
NBP1-59438
Western Blot Tetraspanin-4 Antibody
Western Blot Tetraspanin-4 Antibody
Immunohistochemistry Tetraspanin-4 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
CD45 Antibody
[Unconjugated]
AF114
Immunohistochemistry CD45 Antibody [Unconjugated]
Immunocytochemistry CD45 Antibody [Unconjugated]
Immunocytochemistry/ Immunofluorescence CD45 Antibody [Unconjugated]
(1 Review)
(68 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
TSPAN1 Antibody
NBP2-33867
Immunohistochemistry-Paraffin TSPAN1 Antibody
Immunohistochemistry-Paraffin TSPAN1 Antibody
Immunohistochemistry-Paraffin TSPAN1 Antibody
(4 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(807 Publications)
Species: Hu
Applications: BA

Publications for CD53 Protein (NBP2-14464PEP) (0)

There are no publications for CD53 Protein (NBP2-14464PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD53 Protein (NBP2-14464PEP) (0)

There are no reviews for CD53 Protein (NBP2-14464PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CD53 Protein (NBP2-14464PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CD53 Products

Research Areas for CD53 Protein (NBP2-14464PEP)

Find related products by research area.

Blogs on CD53.

Check out the latest blog posts on CD53.
CD81/TAPA1: I'm on Tapa the Cell
Target of the antiproliferative 1 (TAPA1), also known as CD81, is found in the plasma membrane in lymphocytes and plays an important role in the regulation of lymphoma cell growth. This transmembrane 4 superfamily (TM4SF) protein is primarily found on...  Read full blog post.

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
ICAM-1/CD54 was detected in perfusion fixed frozen sections of mouse testis using Goat Anti-Mouse ICAM-1/CD54 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF796) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to plasma membrane in Leydig cells. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
ICAM-1/CD54 Antibody [Unconjugated]
AF796

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CD53 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol CD53