Home » CD47 » CD47 Proteins » CD47 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

CD47 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for CD47 Protein (NBP2-32031PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

CD47 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD47.

Source: E. coli

Amino Acid Sequence: AQLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CD47
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-32031.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CD47 Recombinant Protein Antigen

  • antigen identified by monoclonal 1D8
  • Antigenic surface determinant protein OA3
  • CD47 antigen (Rh-related antigen, integrin-associated signal transducer)
  • CD47 antigen
  • CD47 glycoprotein
  • CD47 molecule
  • CD47
  • IAP
  • IAPintegrin associated protein
  • Integrin-associated protein
  • leukocyte surface antigen CD47
  • MER6
  • MER6integrin-associated signal transducer
  • OA3
  • Protein MER6
  • Rh-related antigen

Background

CD47 antigen, also known as integrin associated protein (IAP), has a very broad tissue distribution. CD47 is expressed on all hematopoietic cells, including leukocytes, platelets and erythrocytes. It is also expressed on epithelial cells, endothelial cells, fibroblasts and many tumor cell lines. There are approximately 50.000 CD47 molecules per erythrocyte. The glycoprotein is deficient in erythrocytes of the rare Rh null phenotype. CD47 is a heavily N glycosylated cell membrane glycoprotein of apparent molecular weight 47-52 kDa. It may play a role as a signaltransducer in the regulation of cation fluxes across cell membranes and in the chemotactic and adhesive interactions of leukocytes with endothelial cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Western Blot HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
XIAP Antibody
[Unconjugated]
AF8221
Western Blot XIAP Antibody [Unconjugated]
Simple Western XIAP Antibody [Unconjugated]
Knockout Validated XIAP Antibody [Unconjugated]
(24 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
Thrombospondin-1
[HRP]
DTSP10
N/A Thrombospondin-1 [HRP]
(42 Publications)
Species: Hu
Applications: ELISA
Survivin Antibody
- BSA Free
NB500-201
Flow Cytometry Survivin Antibody - BSA Free
Dual RNAscope ISH-IHC Survivin Antibody - BSA Free
Knockdown Validated Survivin Antibody - BSA Free
(22 Reviews)
(374 Publications)
Species: Ca, Fe, Gp, Ha, Hu, Mu, Rt
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(818 Publications)
Species: Hu
Applications: BA
SMAC/Diablo
Antibody
NB100-56311
Western Blot SMAC/Diablo Antibody
Immunohistochemistry SMAC/Diablo Antibody
(16 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Survivin Antibody
- BSA Free
NB500-201
Flow Cytometry Survivin Antibody - BSA Free
Dual RNAscope ISH-IHC Survivin Antibody - BSA Free
Knockdown Validated Survivin Antibody - BSA Free
(22 Reviews)
(374 Publications)
Species: Ca, Fe, Gp, Ha, Hu, Mu, Rt
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
Caspase-3 Antibody
[Unconjugated] - Acti ...
AF835
Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active
Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active
Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active
(7 Reviews)
(389 Publications)
Species: Hu, Mu
Applications: ICC, IHC
SIRP alpha/CD172a
Antibody (OX-41)
NB100-65530
Immunofluorescence SIRP alpha/CD172a Antibody (OX-41)
Immunofluorescence SIRP alpha/CD172a Antibody (OX-41)
Immunofluorescence SIRP alpha/CD172a Antibody (OX-41)
(5 Publications)
Species: Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
cIAP-1/HIAP-2
Antibody [Unconjugate
AF8181
Western Blot cIAP-1/HIAP-2 Antibody [Unconjugated]
Immunohistochemistry cIAP-1/HIAP-2 Antibody [Unconjugated]
Knockout Validated cIAP-1/HIAP-2 Antibody [Unconjugated]
(4 Reviews)
(66 Publications)
Species: Hu
Applications: IHC, KO, Simple Western, WB
cIAP-2/HIAP-1
Antibody [Unconjugate
AF8171
Western Blot cIAP-2/HIAP-1 Antibody [Unconjugated]
Simple Western cIAP-2/HIAP-1 Antibody [Unconjugated]
Immunohistochemistry cIAP-2/HIAP-1 Antibody [Unconjugated]
(17 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
Alkaline
Phosphatase, Intestin ...
NBP3-25355
Western Blot Alkaline Phosphatase, Intestinal Antibody (HL1268) - Azide and BSA Free
Immunohistochemistry-Paraffin Alkaline Phosphatase, Intestinal Antibody (HL1268) - Azide and BSA Free
Western Blot Alkaline Phosphatase, Intestinal Antibody (HL1268) - Azide and BSA Free
Species: Dr, Hu, Mu
Applications: IHC, IHC-P, WB
Bcl-2 Antibody
NB100-56098
Western Blot Bcl-2 Antibody
Western Blot Bcl-2 Antibody
Western Blot Bcl-2 Antibody
(2 Reviews)
(26 Publications)
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Livin Antibody
(88C570) - BSA Free
NB100-56548
Western Blot Livin Antibody (88C570) - BSA Free
(22 Publications)
Species: Hu
Applications: ICC/IF, WB
Caspase-9 Antibody
NB100-56118
Immunohistochemistry Caspase-9 Antibody
Immunohistochemistry Caspase-9 Antibody
Immunohistochemistry Caspase-9 Antibody
(1 Review)
(28 Publications)
Species: Ca, Ma, Hu, Mu, Rt
Applications: Flow-IC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
L1CAM Antibody
(UJ127.11) - BSA Free
NB100-2682
Flow Cytometry L1CAM Antibody (UJ127.11) - BSA Free
Western Blot L1CAM Antibody (UJ127.11) - BSA Free
Immunohistochemistry-Paraffin L1CAM Antibody (UJ127.11) - BSA Free
(2 Reviews)
(4 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow-CS, Flow, ICC/IF, IF, IHC, IHC-Fr, IHC-P, IP, WB
TRAIL/TNFSF10
[Unconjugated]
375-TL
TRAIL/TNFSF10 [Unconjugated]
(1 Review)
(54 Publications)
Species: Hu
Applications: BA
CD47 Recombinant
Protein Antigen
NBP2-32031PEP
CD47 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for CD47 Protein (NBP2-32031PEP) (0)

There are no publications for CD47 Protein (NBP2-32031PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD47 Protein (NBP2-32031PEP) (0)

There are no reviews for CD47 Protein (NBP2-32031PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CD47 Protein (NBP2-32031PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CD47 Products

Research Areas for CD47 Protein (NBP2-32031PEP)

Find related products by research area.

Blogs on CD47

There are no specific blogs for CD47, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
fWestern blot shows lysates of U937 human histiocytic lymphoma cell line and human placenta tissue, not heated to minimize aggregation. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human CD47 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4670) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). Specific bands were detected for CD47 at approximately 45-70 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
CD47 Antibody [Unconjugated]
AF4670
Caspase‑3 was detected in immersion fixed anti-FAS treated Jurkat human acute T cell leukemia cell line using 0.3 µg/mL Human/Mouse Active Caspase‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF835) for 3 hours at room temperature. Cells were stained (red) and counterstained (green). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Caspase-3 Antibody [Unconjugated] - Active
AF835

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CD47 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol CD47