![Western Blot: CD14 Antibody [NBP1-86166] - Analysis using Anti-CD14 antibody NBP1-86166 (A) shows similar pattern to independent antibody NBP1-86168 (B).](http://images.novusbio.com/fullsize/CD14-Antibody-Western-Blot-NBP1-86166-img0013.jpg "Western Blot: CD14 Antibody [NBP1-86166] - Analysis using Anti-CD14 antibody NBP1-86166 (A) shows similar pattern to independent antibody NBP1-86168 (B).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVGVSGTLVLLQG |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CD14 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | IHC-P reported in scientific literature (PMID: 30049749). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for CD14 Antibody (NBP1-86166)Find related products by research area.
|
|
The role of TLR4 in breast cancer Toll like receptors (TLRs) are highly conserved proteins that are first known for their role in pathogen recognition and immune response activation. In order to elicit the necessary immune response in reaction to a foreign pathogen, TLRs trigger cy... Read full blog post. |
|
CD14 - TLR4 is my friend in battle against infections! CD14 is a well-characterized cell-activating receptor for lipopolysaccharide-binding protein (LBP) and peptidoglycan. It is an important modulator for lipopolysaccharide (LPS)-dependent signaling and is a component of the multi-protein complex contain... Read full blog post. |
|
CD11b: Marker for a New Type of B Cell that Participates in Cell-Mediated Immunity Think B lymphocytes just produce antibodies? Think again! Although, of course, B cells are vital for the humoral immune response, many studies in recent years have begun to uncover antibody-independent actions of B cells: regulating T cells and thus a... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CD14 |
![Immunohistochemistry-Paraffin: CD14 Antibody [NBP1-86166] - Staining of human liver shows moderate to strong membranous positivity in hepatic sinusoid cells.](http://images.novusbio.com/fullsize/CD14-Antibody-Immunohistochemistry-Paraffin-NBP1-86166-img0018.jpg "Immunohistochemistry-Paraffin: CD14 Antibody [NBP1-86166] - Staining of human liver shows moderate to strong membranous positivity in hepatic sinusoid cells.")
![Immunohistochemistry-Paraffin: CD14 Antibody [NBP1-86166] - Staining of human liver, lymph node, pancreas and rectum using Anti-CD14 antibody NBP1-86166 (A) shows similar protein distribution across tissues to independent antibody NBP1-86168 (B).](http://images.novusbio.com/fullsize/CD14-Antibody-Western-Blot-NBP1-86166-img0012.jpg "Immunohistochemistry-Paraffin: CD14 Antibody [NBP1-86166] - Staining of human liver, lymph node, pancreas and rectum using Anti-CD14 antibody NBP1-86166 (A) shows similar protein distribution across tissues to independent antibody NBP1-86168 (B).")
![Immunohistochemistry-Paraffin: CD14 Antibody [NBP1-86166] - Analysis in human lymph node and pancreas tissues. Corresponding CD14 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/CD14-Antibody-Immunohistochemistry-Paraffin-NBP1-86166-img0014.jpg "Immunohistochemistry-Paraffin: CD14 Antibody [NBP1-86166] - Analysis in human lymph node and pancreas tissues. Corresponding CD14 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: CD14 Antibody [NBP1-86166] - Staining of human lymph node shows moderate to strong membranous positivity in lymphoid cells.](http://images.novusbio.com/fullsize/CD14-Antibody-Immunohistochemistry-Paraffin-NBP1-86166-img0015.jpg "Immunohistochemistry-Paraffin: CD14 Antibody [NBP1-86166] - Staining of human lymph node shows moderate to strong membranous positivity in lymphoid cells.")
![Immunohistochemistry-Paraffin: CD14 Antibody [NBP1-86166] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.](http://images.novusbio.com/fullsize/CD14-Antibody-Immunohistochemistry-Paraffin-NBP1-86166-img0016.jpg "Immunohistochemistry-Paraffin: CD14 Antibody [NBP1-86166] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.")
![Immunohistochemistry-Paraffin: CD14 Antibody [NBP1-86166] - Staining of human rectum shows moderate to strong cytoplasmic positivity in lymphoid cells.](http://images.novusbio.com/fullsize/CD14-Antibody-Immunohistochemistry-Paraffin-NBP1-86166-img0017.jpg "Immunohistochemistry-Paraffin: CD14 Antibody [NBP1-86166] - Staining of human rectum shows moderate to strong cytoplasmic positivity in lymphoid cells.")
![Immunohistochemistry-Paraffin: CD14 Antibody [NBP1-86166] - Staining of human tonsil shows moderate membranous positivity in germinal center cells.](http://images.novusbio.com/fullsize/CD14-Antibody-Immunohistochemistry-Paraffin-NBP1-86166-img0019.jpg "Immunohistochemistry-Paraffin: CD14 Antibody [NBP1-86166] - Staining of human tonsil shows moderate membranous positivity in germinal center cells.")
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![N/A IL-10 [Biotin]](https://images.novusbio.com/images2/DATA_IL10_DY417_ELISA_2014.jpg)
![N/A LBP [Biotin]](https://images.novusbio.com/images2/DATA_LBP_DY87005_ELISA_2551.jpg)
![Bioactivity IL-4 [Unconjugated]](https://images.novusbio.com/images/protein/6507-ilcf_recombinant-human-il-4-cho-expressed-protein-cf-bioactivity-272020133214.jpg)
![Immunohistochemistry CD34 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD34_AF4117_Immunohistochemistry_6824.jpg)
![Western Blot Fc gamma RIII (CD16) Antibody [Unconjugated]](https://images.novusbio.com/images2/Fc_gamma_RIII_AF1597_Western_Blot_23213.jpg)
![SDS-PAGE Fc gamma RIIIA/CD16a [Unconjugated]](https://images.novusbio.com/images2/Fc_gamma_RIIIA_4325-FC_411.jpg)
![Binding Activity Fc gamma RIIIA/CD16a [Unconjugated]](https://images.novusbio.com/images2/Fc_gamma_RIIIA_4325-FC_491.jpg)
![SEC-MALS Fc gamma RIIIA/CD16a [Unconjugated]](https://images.novusbio.com/images/4325-fc_recombinant-human-fc-gamma-riiia-cd16a-protein-cf-sec-mals-2842023172947.jpg)
![Immunohistochemistry CD45 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD45_AF114_Immunohistochemistry_23525.jpg)
![Immunocytochemistry CD45 Antibody [Unconjugated]](https://images.novusbio.com/images2/af114_mouse-cd45-affinity-purified-polyclonal-ab-immunocytochemistry-6122021145449.jpg)
![Immunocytochemistry/ Immunofluorescence CD45 Antibody [Unconjugated]](https://images.novusbio.com/images/af114_mouse-cd45-affinity-purified-polyclonal-ab-41202410331954.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")