I learn from your company web that you are providing atf6, xbp1, cbx4 antibodies against human for immunofluorescence. And from the provided pictures, it seems very good. But I am wondering if anyone use them for immunofluorescence in human cells in your memory or in published papers? And how about them? By the way, you are providing free sample size for the atf6, xbp1 antibodies, aren't you? Could you send me some for tests? One more question, do they work on endogenous proteins but not only on overexpressed proteins?

Name: CBX4 Antibody
Brand: Novus Biologicals
SKU: NBP1-83225
Price: 499 USD

Question

Accepted Answer

These products have been validated for use in IF on human: catalog numbers NBP1-40256, NB100-80861, and NBP1-83225. Yes these antibodies should work on the native protein/endogenous protein.

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Reactivity	HuSpecies Glossary
Applications	IHC
Clonality	Polyclonal
Host	Rabbit
Conjugate	Unconjugated

Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids: QPEVILLDSDLDEPIDLRCVKTRSEAGEPPSSLQVKPETPASAAVAVAAAAAPTTTAEKPPAEAQDEPAESLSEFKPFFGNIIITDVTANCLTVTFKEYVTV
Isotype	IgG
Clonality	Polyclonal
Host	Rabbit
Gene	CBX4
Purity	Immunogen affinity purified
Innovator's Reward	Test in a species/application not listed above to receive a full credit towards a future purchase. Learn about the Innovator's Reward

Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer	PBS (pH 7.2) and 40% Glycerol
Preservative	0.02% Sodium Azide
Purity	Immunogen affinity purified

Publications using NBP1-83225	Applications	Species
Peuget S, Bonacci T, Soubeyran P et al. Oxidative stress-induced p53 activity is enhanced by a redox-sensitive TP53INP1 SUMOylation. Cell Death Differ 2014-07-01 [PMID: 24608790] (WB)	WB
Ismail IH, Gagne JP, Caron MC et al. CBX4-mediated SUMO modification regulates BMI1 recruitment at sites of DNA damage Nucleic Acids Res 2012-03-08 [PMID: 22402492] (ICC/IF, Human)	ICC/IF	Human

CBX4 Antibody

Species Glossary

Images

Product Details

Order Details

CBX4 Antibody Summary

Applications/Dilutions

Reactivity Notes

Packaging, Storage & Formulations

Alternate Names for CBX4 Antibody

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for CBX4 Antibody (NBP1-83225)(2)

Reviews for CBX4 Antibody (NBP1-83225) (0)

Product General Protocols

FAQs for CBX4 Antibody (NBP1-83225). (Showing 1 - 2 of 2 FAQs).

Secondary Antibodies

Isotype Controls

Additional CBX4 Products

Research Areas for CBX4 Antibody (NBP1-83225)

Blogs on CBX4

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics