We would like to check on Cystathionine beta synthase # H00000875-M01. We need a mouse monoclonal. Applications: Immunoblotting, IHC May I know if this can cross-react with mouse CBS? Because we are actually probing this enzyme in a mouse cell line / tissue and the species is human, host is mouse.

This antibody has never been tested against mouse samples so we don't know if it will cross react. I recommend checking with a blast against the mouse protein to find out how similar the immunogen is to the mouse protein. If it is 80% homologous or higher typically there is a good chance it might react. In addition to using an anti-mouse secondary will bind non-specifically to their mouse tissues, and most likely cause high background. Running a secondary only control would be advised or even better increase the concentration of the primary on their samples and use a directly conjugated version to avoid non-specific secondary binding. In this case we can recommend our Innovators Reward Program. Our Innovator's Reward is offered to reward researchers for testing new species and applications with our products. If testing on this antibody is performed on an untested species and/or application, and the results are shared, then the antibody is eligible for the Innovator's Reward. Under this program, Novus will provide you a credit of equal or lesser value on a future product of equal value in exchange for your new data in the form of an online review. The great thing is you are eligible even if the antibody doesn't work because the data is still useful to us.

I was wondering if the CBS Antibody (3E1) (H00000875-M01) has been used for immunofluorescence on monolayer cell cultures?

Unfortunately it has never been tested for immunofluorescence in an ICC application on cells. Since it stains tissue, I would imagine it should be capable of staining cells as well. Without testing we cannot guarantee this, but if you want to test using our Innovators Reward Program to save some money for providing feedback that is an option for you. Here are the details: If you would like to test this antibody in an untested species and/or application and share your results with us, then I can recommend our Innovators Reward program. Under this program, Novus will provide you a 50% refund on the purchased product as well as a 50% discount on a future product of equal value in exchange for your new data. The great thing is you are eligible regardless if you get positive results or not.

CBS Antibody (3E1) (H00000875-M01): Novus Biologicals

Name: CBS Antibody (3E1)
Brand: Novus Biologicals
SKU: H00000875-M01
Rating: 3 (1 reviews)

- COVID-19 Research Tools
  
  Antibodies
  Primary Antibodies
  Conjugated Antibodies
  
  Sample Size Antibodies
  
  KO Validated Antibodies
  
  Recombinant Antibodies
  
  Antibody Sampler Packs
  
  Antibody Pairs
  
  Secondary Antibodies
  
  Isotype Control Antibodies
  
  Proteins and Peptides
  Peptides & Proteins
  
  Blocking Peptides
  
  Biologically Active Proteins
  
  Lysates and Cell Lines
  Lysates
  
  Stem Cell Lines
- Kits
  Antibody Labeling Kits
  
  ChIP Kits
  
  ELISA Kits
  
  Flow Cytometry Kits
  
  Activators and Inhibitors
  Inhibitors
  
  Activators
  
  Support Products
  Exosome Isolation
  
  Flow Cytometry Beads
  
  IHC Tissue Slides
  
  IHC Microarrays
  
  Western Blot Gels & Buffers
  
  Western Blot Membranes
  
  All Support Products
  
  Bulk and Custom
Products
Our Protocols
- Resources
  Protocols
  
  Video Protocols
  
  Troubleshooting Guides
  
  Posters and Literature
  
  Handbooks and Guides
  
  Calculators
  
  FAQs
  
  Blogs
  
  Diseases
  
  Whitepapers
  
  Antibody Concierge
  
  Webinars
- Tools
  Spectra Viewer
  
  Flow Cytometry Panel Builder
  
  Application
  ELISA
  
  Flow Cytometry
  
  Mass Cytometry (CyTOF)
  
  ICC
  
  IHC
  
  Western Blotting
  
  Interviews
  Faculty
  
  Postdoc
Resources
View Pathways
- By Research Area
  Apoptosis
  
  Autophagy
  
  Cancer
  
  Cell Biology
  
  Cellular Markers
  
  Epigenetics
  
  Epitope Tags
  
  Exosomes Research
  
  Hypoxia
  
  Immunology
  
  Microbiology
  
  Neuroscience
  
  Stem Cells
- By Pathway
  AKT
  
  Apoptosis
  
  Autophagy
  
  ERK1/2/5 Pathway
  
  Hedgehog
  
  Hippo
  
  JNK Pathway
  
  mTOR
  
  Necroptosis
  
  NFKB Signaling
  
  p38 Signaling
  
  TGF Beta
  
  TLR
Research Areas
Get Rewards
- Customer Care
  100% Guarantee
  
  Risk Free Testing
  
  Novus Rewards Program
  
  Publication Rewards Program
  
  New Lab Discount
  
  Scholarship
  
  Travel Grants
  
  Promotions
Customer Care
Novus Careers
- About us
  Careers
  
  Collaborations
  
  Events
  
  Novus Story
  
  Our Team
  
  Philanthropy
  
  Press Releases
  
  Why choose Novus
About Us
- Contact Us
  Customer Service
  
  Distributors
  
  Technical Support
Contact

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Reactivity	Hu, Mu, Rt, Po, BaSpecies Glossary
Applications	WB, ELISA, ICC/IF, IHC, IP, KD
Clone	3E1
Clonality	Monoclonal
Host	Mouse
Conjugate	Unconjugated

Description	Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen	CBS (NP_000062, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFG
Specificity	CBS - cystathionine-beta-synthase
Isotype	IgG2a Kappa
Clonality	Monoclonal
Host	Mouse
Gene	CBS
Purity	IgG purified
Innovator's Reward	Test in a species/application not listed above to receive a full credit towards a future purchase. Learn about the Innovator's Reward

Storage	Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer	In 1x PBS, pH 7.4
Preservative	No Preservative
Purity	IgG purified

Publications using H00000875-M01	Applications	Species
Qamarul A, Tomoaki I, Masanobu M et al. Synthesis of Sulfides and Persulfides Is Not Impeded by Disruption of Three Canonical Enzymes in Sulfur Metabolism. Antioxidants (Basel). 2023-04-03 [PMID: 37107243]
Hwang SY, Sarna LK, Siow YL et al. High fat diet stimulates hepatic cystathionine ?-synthase and cystathionine ?-lyase expression. Canadian Journal of Physiology and Pharmacology Jun 13 2013
Tain Y, Hou C, Chang-Chien G et al. Protection by Means of Perinatal Oral Sodium Thiosulfate Administration against Offspring Hypertension in a Rat Model of Maternal Chronic Kidney Disease Antioxidants 2023-06-26 [PMID: 37507884] (WB, Rat) Details: 1:500 WB dilution	WB	Rat
Doyoung K, Seung S, Sou K et al. Effects of dietary restriction on hepatic sulfur-containing amino acid metabolism and its significance in acetaminophen-induced liver injury. J Nutr Biochem. 2022-06-10 [PMID: 35697284]
Halina J, Maria W, Ewa J et al. Sulfurtransferases and Cystathionine Beta-Synthase Expression in Different Human Leukemia Cell Lines. Biomolecules. 2022-01-18 [PMID: 35204649]
Bibli S, Hu J, Leisegang M et al. Shear stress regulates cystathionine ? lyase expression to preserve endothelial redox balance and reduce membrane lipid peroxidation. Redox Biol. 2019-11-13 [PMID: 31759247]
Yue Shang Y, Siow YL, Isaak CK, Karmin O Downregulation of Glutathione Biosynthesis Contributes to Oxidative Stress and Liver Dysfunction in Acute Kidney Injury. Oxid Med Cell Longev 2016-01-01 [PMID: 27872680]
Sekiguchi F, Sekimoto T, Ogura A, Kawabata A. Endogenous Hydrogen Sulfide Enhances Cell Proliferation of Human Gastric Cancer AGS Cells. Biol Pharm Bull 2016-05-13 [PMID: 27150157]
Tai I, Sheen J, Lin Y et al. Maternal N-acetylcysteine therapy regulates hydrogen sulfide-generating pathway and prevents programmed hypertension in male offspring exposed to prenatal dexamethasone and postnatal high-fat diet. Nitric Oxide 2015-01-01 [PMID: 26743493]
Ren YS, Wu SY, Wang XJ et al. Multiple hemodynamic effects of endogenous hydrogen sulfide on central nervous system in rats. Chin Med J Jun 5 2011
Ohmura M, Hishiki T, Yamamoto T et al. Impacts of CD44 knockdown in cancer cells on tumor and host metabolic systems revealed by quantitative imaging mass spectrometry. Nitric Oxide Nov 11 2014
Yuan B, Tang WH, Lu LJ et al. TLR4 upregulates CBS expression through NF-kB activation in a rat model of irritable bowel syndrome with chronic visceral hypersensitivity. World J Gastroenterol. 2015-07-28 [PMID: 26229403]
Yuan B, Tang WH, Lu LJ et al. TLR4 upregulates CBS expression through NF-?B activation in a rat model of irritable bowel syndrome with chronic visceral hypersensitivity. World J Gastroenterol Jul 28 2015
Fofou-Caillierez MB, Gueant-Rodriguez RM, Alberto JM et al. Vitamin B-12 and liver activity and expression of methionine synthase are decreased in fetuses with neural tube defects Am. J. Clin. Nutr. 2019-03-06 [PMID: 30848279] (WB, Human)	WB	Human
Wang L, Cai H, Hu Y et al. A pharmacological probe identifies cystathionine ?-synthase as a new negative regulator for ferroptosis. Cell Death Dis 2018-09-26 [PMID: 30258181]
Bibli SI, Luck B, Zukunft S et al. A selective and sensitive method for quantification of endogenous polysulfide production in biological samples. Redox Biol 2018-07-21 [PMID: 30077923]
Ohmura M, Hishiki T, Yamamoto T et al. Impacts of CD44 knockdown in cancer cells on tumor and host metabolic systems revealed by quantitative imaging mass spectrometry. Nitric Oxide. 2014-01-01 [PMID: 25461272]
Du Chenchen, Jin Mengmeng, Hong Yu et al. Downregulation of cystathionine beta-synthase/hydrogen sulfide contributes to rotenone-induced microglia polarization toward M1 type. Biochem Biophys Res Commun. 2014-08-22 [PMID: 25086357] (Mouse)		Mouse
Takano N, Sarfraz Y, Gilkes DM et al. Decreased Expression of Cystathionine b-Synthase Promotes Glioma Tumorigenesis. Mol Cancer Res. 2014-07-03 [PMID: 24994751]
Ida T, Sawa T, Ihara H et al. Reactive cysteine persulfides and S-polythiolation regulate oxidative stress and redox signaling. Proc Natl Acad Sci U S A. 2014-04-14 [PMID: 24733942]
Yamamoto Takehiro, Takano Naoharu, Ishiwata Kyoko et al. Reduced methylation of PFKFB3 in cancer cells shunts glucose towards the pentose phosphate pathway. Nat Commun. 2014-03-17 [PMID: 24633012] (WB, Human)	WB	Human
Miyamoto Ryo, Otsuguro Ken-Ichi, Yamaguchi Soichiro, Ito Shigeo. Contribution of cysteine aminotransferase and mercaptopyruvate sulfurtransferase to hydrogen sulfide production in peripheral neurons. J Neurochem. 2014-03-27 [PMID: 24611772] (Rat)		Rat
Takano N, Peng YJ, Kumar GK et al. Hypoxia-inducible factors regulate human and rat cystathionine b-synthase gene expression. Biochem J. 2013-12-12 [PMID: 24328859]
Hwang SY, Sarna LK, Siow YL, O K. High fat diet stimulates hepatic cystathionine beta-synthase and cystathionine gamma-lyase expression. Canadian Journal of Physiology and Pharmacology. 2013-01-01 [PMID: 24117258]
Teng H, Wu B, Zhao K et al. Oxygen-sensitive mitochondrial accumulation of cystathionine beta-synthase mediated by Lon protease. Proc Natl Acad Sci U S A 2013-07-30 [PMID: 23858469] (WB, Human, Mouse)	WB	Human, Mouse
Hu S, Xu W, Miao X et al. Sensitization of sodium channels by cystathionine b-synthetase activation in colon sensory neurons in adult rats with neonatal maternal deprivation. Exp Neurol. 2013-07-06 [PMID: 23834820]
Zhang HH, Hu J, Zhou YL et al. Promoted Interaction of Nuclear Factor-kB with Demethylated Cystathionine-beta-Synthetase Gene Contributes to Gastric Hypersensitivity in Diabetic Rats. J Neurosci. 2013-05-22 [PMID: 23699514]
Yang HY, Wu ZY, Wood M et al. Hydrogen sulfide attenuates opioid dependence by suppression of adenylate cyclase/cAMP pathway. Antioxid Redox Signal. 2013-05-18 [PMID: 23682813]
Liu Y, Luo H, Liang C et al. Actions of Hydrogen Sulfide and ATP-Sensitive Potassium Channels on Colonic Hypermotility in a Rat Model of Chronic Stress. PLoS One. 2013-02-06 [PMID: 23405222]
Shi L, Zhang HH, Xiao Y et al. Electroacupuncture Suppresses Mechanical Allodynia and Nuclear Factor Kappa B Signaling in Streptozotocin-Induced Diabetic Rats. CNS Neurosci Ther. 2012-12-11 [PMID: 23230847]
Rashid S, Heer JK, Garle MJ et al. Hydrogen Sulphide-induced relaxation of porcine peripheral bronchioles. Br J Pharmacol. 2012-12-06 [PMID: 23215842]
Yang G, Zhao K, Ju Y et al. Hydrogen sulfide protects against cellular senescence via S-sulfhydration of Keap1 and activation of Nrf2. Antioxid Redox Signal. 2013-02-07 [PMID: 23176571]
Dufton N, Natividad J, Verdu EF, Wallace JL. Hydrogen sulfide and resolution of acute inflammation: A comparative study utilizing a novel fluorescent probe. Sci Rep. 2012-07-09 [PMID: 22787557]
Qipshidze N, Metreveli N, Mishra PK et al. Hydrogen Sulfide Mitigates Cardiac Remodeling During Myocardial Infarction via Improvement of Angiogenesis Int J Biol Sci 2012-01-01 [PMID: 22419888] (WB, Mouse)	WB	Mouse
Holwerda KM, Bos EM, Rajakumar A et al. Hydrogen sulfide producing enzymes in pregnancy and preeclampsia. Placenta. 2012-03-03 [PMID: 22391326]
Lu YH, Huang YH, Cheng LM et al. Homocystinuria in Taiwan: An inordinately high prevalence in an Austronesian aboriginal tribe, Tao. Molecular Genetics and Metabolism. 2012-01-01 [PMID: 22353391]
Ren YS, Wu SY, Wang XJ et al. Multiple hemodynamic effects of endogenous hydrogen sulfide on central nervous system in rats. Chin Med J. 2011-01-01 [PMID: 22340160]
Guo H, Gai JW, Wang Y et al. Characterization of Hydrogen Sulfide and Its Synthases, Cystathionine b-Synthase and Cystathionine gamma-Lyase, in Human Prostatic Tissue and Cells. Urology. 2012-02-01 [PMID: 22310774]
Pei Y, Wu B, Cao Q et al. Hydrogen sulfide mediates the anti-survival effect of sulforaphane on human prostate cancer cells. Toxicology and Applied Pharmacology. 2011-10-08 [PMID: 22005276]
Streeter E, Al-Magableh M, Hart JL, Badoer E. Hydrogen Sulfide in the RVLM and PVN has No Effect on Cardiovascular Regulation. Front Physiol. 2011-09-01 [PMID: 21941511]
Roy A, Khan AH, Islam MT et al. Interdependency of cystathione gamma-lyase and cystathione beta-synthase in hydrogen sulfide-induced blood pressure regulation in rats. Am J Hypertens. 2012-01-01 [PMID: 21866187] (WB, Rat)	WB	Rat
Mislanova C, Martsenyuk O, Huppertz B, Obolenskaya MY. Placental markers of folate-related metabolism in preeclampsia. Reproduction. 2011-06-20 [PMID: 21690209]
Kasparek MS, Linden DR, Farrugia G, Sarr MG. Hydrogen sulfide modulates contractile function in rat jejunum. J Surg Res. 2012-06-15 [PMID: 21571312] (ICC/IF, Rat)	ICC/IF	Rat
Yamamoto T, Takano N, Ishiwata K, Suematsu M. Carbon monoxide stimulates global protein methylation via its inhibitory action on cystathionine beta-synthase. J. 2010-11-10 [PMID: 21297920]
Predmore BL, Alendy MJ, Ahmed KI et al. The hydrogen sulfide signaling system: changes during aging and the benefits of caloric restriction. Age (Dordr). 2010-05-26 [PMID: 20502969]
Majtan T, Liu L, Carpenter JF, Kraus JP. Rescue of cystathionine beta-synthase (CBS) mutants with chemical chaperones: purification and characterization of eight CBS mutant enzymes. J Biol Chem. 2010-03-22 [PMID: 20308073]
Li Q, Sun B, Wang X et al. A crucial role for hydrogen sulfide in oxygen sensing via modulating large conductance calcium-activated potassium channels. Antioxid Redox Signal;12(10):1179-89. 2010-05-15 [PMID: 19803741]
Hennig B, Diener M. Actions of hydrogen sulphide on ion transport across rat distal colon. Br J Pharmacol;158(5):1263-75. 2009-11-01 [PMID: 19785650]
Xu, GY, Winston, JH, Shenoy, M. The endogenous hydrogen sulfide producing enzyme cystathionine-beta synthase contributes to visceral hypersensitivity in a rat model of irritable bowel syndrome. Mol Pain;5:44. 2009-08-06 [PMID: 19660142]
Lee M, Schwab C, Yu S et al. Astrocytes produce the antiinflammatory and neuroprotective agent hydrogen sulfide. Neurobiol Aging;30(10):1523-34. 2009-10-01 [PMID: 19631409]
Martin GR, McKnight GW, Dicay MS et al. Hydrogen sulphide synthesis in the rat mouse gastrointestinal tract. Dig Liver Dis. 2009-06-29 [PMID: 19570733]
Wallace JL, Vong L, McKnight W et al. Endogenous and Exogenous Hydrogen Sulfide Promotes Resolution of Colitis in Rats. Gastroenterology. 2009-04-15 [PMID: 19375422]
Majtan T, Singh LR, Wang L et al. Active CBS can be expressed in heme-free systems in the presence of metal-substituted porphyrins or a chemical chaperone. J Biol Chem;283(50):34588-95. 2008-12-12 [PMID: 18849566]
Sen, U, N Tyagi et al (2007). Cystathionine {beta}-synthase gene transfer 3-Deazaadenosine ameliorate inflammatory response in endothelial cells. Am J Physiol Cell Physiol;293(6):C1779-87. 2007-12-01 [PMID: 17855772]
Wallace JL, Dicay M, McKnight W et al. Hydrogen sulfide enhances ulcer healing in rats. FASEB J;21(14):4070-6. 2007-12-01 [PMID: 17634391]
Schicho R, Krueger D, Zeller F et al. Hydrogen sulfide is a novel prosecretory neuromodulator in the Guinea-pig human colon. Gastroenterology;131(5):1542-52. 2006-11-01 [PMID: 17101327]
Dai J, Sullivan BA, Higgins JM et al. Regulation of mitotic chromosome cohesion by Haspin and Aurora B. Dev Cell 2006-11-01 [PMID: 17084365]
Show All 57 Publications. Collapse Publications.

CBS Antibody (3E1)

Species Glossary

Images

Product Details

Order Details

CBS Antibody (3E1) Summary

Applications/Dilutions

Reactivity Notes

Packaging, Storage & Formulations

Notes

Alternate Names for CBS Antibody (3E1)

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for CBS Antibody (H00000875-M01)(57)

Review for CBS Antibody (H00000875-M01) (1) 31

Summary

Product General Protocols

Video Protocols

FAQs for CBS Antibody (H00000875-M01). (Showing 1 - 2 of 2 FAQs).

Secondary Antibodies

Isotype Controls

Additional CBS Products

Research Areas for CBS Antibody (H00000875-M01)

Blogs on CBS

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Recent Reviews

Bioinformatics

Gene Symbol	CBS
Entrez	875(Human)
OMIM	236200(Human)
Uniprot	NP_000062(Human)

	Verified Customer 02/02/2010
Application:	WB
Species:	Mouse