Home » Caveolin-2 » Caveolin-2 Peptides and Proteins » Recombinant Human Caveolin-2 GST (N-Term) Protein
Novus Biologicals products are now on bio-techne.com

Recombinant Human Caveolin-2 GST (N-Term) Protein

 Submit a Review

Images

 
(
Enlarge)
SDS-Page: Recombinant Human Caveolin-2 Protein [H00000858-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
SDS-Page: Recombinant Human Caveolin-2 Protein [H00000858-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Recombinant Human Caveolin-2 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-162 of Human CAV2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MGLETEKADVQLFMDDDSYSHHSGLEYADPEKFADSDQDRDPHRLNSHLKLGFEDVIAEPVTTHSFDKVWICSHALFEISKYVMYKFLTVFLAIPLAFIAGILFATLSCLHIWILMPFVKTCLMVLPSVQTIWKSVTDVIIAPLCTSVGRCFSSVSLQLSQD
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
CAV2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
44.7 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Caveolin-2 GST (N-Term) Protein

  • CAV
  • CAV2
  • caveolae protein, 20-kD
  • caveolin 2 isoform a and b
  • caveolin 2
  • Caveolin2
  • Caveolin-2
  • MGC12294

Background

The protein encoded by this gene is a major component of the inner surface of caveolae, small invaginations of the plasma membrane, and is involved in essential cellular functions, including signal transduction, lipid metabolism, cellular growth control and apoptosis. This protein may function as a tumor suppressor. CAV1 and CAV2 are located next to each other on chromosome 7 and express colocalizing proteins that form a stable hetero-oligomeric complex. Two transcript variants encoding distinct isoforms have been identified for this gene. By using alternative initiation codons in the same reading frame, two isoforms (alpha and beta) are encoded by one transcript. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Caveolin-1
Antibody (7C8)
NB100-615
Flow Cytometry Caveolin-1 Antibody (7C8)
Flow Cytometry Caveolin-1 Antibody (7C8)
Immunocytochemistry/ Immunofluorescence Caveolin-1 Antibody (7C8)
(3 Reviews)
(37 Publications)
Species: Hu, Mu, Rt, Sh
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Caveolin-3 Antibody
NB110-5029
Immunocytochemistry/ Immunofluorescence Caveolin-3 Antibody
Immunocytochemistry/ Immunofluorescence Caveolin-3 Antibody
Immunohistochemistry-Paraffin Caveolin-3 Antibody
(2 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
eNOS Antibody -
BSA Free
NB300-500
Western Blot eNOS Antibody - BSA Free
Immunohistochemistry-Paraffin eNOS Antibody - BSA Free
Immunohistochemistry-Paraffin eNOS Antibody - BSA Free
(3 Reviews)
(28 Publications)
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr, IHC-P, WB
ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Nanos3 Antibody -
BSA Free
NBP1-76919
Immunocytochemistry/ Immunofluorescence Nanos3 Antibody - BSA Free
Western Blot Nanos3 Antibody - BSA Free
Immunohistochemistry-Paraffin Nanos3 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
EGF [Unconjugated]
236-EG
SDS-PAGE EGF [Unconjugated]
Bioactivity EGF [Unconjugated]
Cell Culture EGF [Unconjugated]
(821 Publications)
Species: Hu
Applications: BA
iNOS Antibody -
BSA Free
NB300-605
Western Blot iNOS Antibody - BSA Free
Western Blot iNOS Antibody - BSA Free
Western Blot iNOS Antibody - BSA Free
(3 Reviews)
(130 Publications)
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
Insulin Receptor
beta Antibody
NBP2-12793
Immunohistochemistry-Paraffin Insulin Receptor beta Antibody
Immunoprecipitation Insulin Receptor beta Antibody
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
AP3B1 Antibody
NBP1-89228
Immunocytochemistry/ Immunofluorescence AP3B1 Antibody
Immunohistochemistry-Paraffin AP3B1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
nNOS Antibody
NB100-858
Immunocytochemistry/ Immunofluorescence nNOS Antibody
Flow Cytometry nNOS Antibody
Immunocytochemistry/ Immunofluorescence nNOS Antibody
(1 Review)
(15 Publications)
Species: Gp, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, PEP-ELISA, WB
Glut4 Antibody -
BSA Free
NBP1-49533
Flow (Intracellular) Glut4 Antibody - BSA Free
Western Blot Glut4 Antibody - BSA Free
Western Blot Glut4 Antibody - BSA Free
(4 Reviews)
(41 Publications)
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(49 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Prolyl
Oligopeptidase/PREP A
NBP2-33950
Immunocytochemistry/ Immunofluorescence Prolyl Oligopeptidase/PREP Antibody
Immunohistochemistry-Paraffin Prolyl Oligopeptidase/PREP Antibody
Immunohistochemistry-Paraffin Prolyl Oligopeptidase/PREP Antibody
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
FMN1 Antibody (4F4)
H00342184-M07
ELISA FMN1 Antibody (4F4)
Immunocytochemistry/ Immunofluorescence FMN1 Antibody (4F4)
Western Blot FMN1 Antibody (4F4)
Species: Hu
Applications: ELISA, ICC/IF, WB
FoxC2 Antibody
AF6989
Immunohistochemistry FoxC2 Antibody
Immunohistochemistry FoxC2 Antibody
Immunohistochemistry FoxC2 Antibody
(26 Publications)
Species: Mu
Applications: IHC
EGFR Antibody
[Unconjugated]
AF231
Immunohistochemistry EGFR Antibody [Unconjugated]
Immunocytochemistry EGFR Antibody [Unconjugated]
Western Blot EGFR Antibody [Unconjugated]
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB

Publications for Caveolin-2 Recombinant Protein (H00000858-P01) (0)

There are no publications for Caveolin-2 Recombinant Protein (H00000858-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Caveolin-2 Recombinant Protein (H00000858-P01) (0)

There are no reviews for Caveolin-2 Recombinant Protein (H00000858-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Caveolin-2 Recombinant Protein (H00000858-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Caveolin-2 Products

Research Areas for Caveolin-2 Recombinant Protein (H00000858-P01)

Find related products by research area.

Blogs on Caveolin-2

There are no specific blogs for Caveolin-2, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Immunohistochemistry-Paraffin: Caveolin-2 Antibody [NBP1-31116] - FaDu xenograft, using Caveolin 2 antibody at 1:500 dilution. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
Caveolin-2 Antibody
NBP1-31116

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Caveolin-2 GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol CAV2