![Immunohistochemistry-Paraffin: Carbonic Anhydrase X/CA10 Antibody [NBP2-31586] - Staining of human placenta shows no positivity in trophoblastic cells as expected.](http://images.novusbio.com/fullsize/Carbonic-Anhydrase-X-CA10-Antibody-Immunohistochemistry-Paraffin-NBP2-31586-img0009.jpg "Immunohistochemistry-Paraffin: Carbonic Anhydrase X/CA10 Antibody [NBP2-31586] - Staining of human placenta shows no positivity in trophoblastic cells as expected.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: HRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRMLNR |
| Predicted Species | Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CA10 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot Carbonic Anhydrase VIII/CA8 Antibody [Unconjugated]](https://images.novusbio.com/images2/Carbonic_Anhydrase_VIII_AF2187_Western_Blot_20462.jpg)
![Simple Western Carbonic Anhydrase VIII/CA8 Antibody [Unconjugated]](https://images.novusbio.com/images2/Carbonic_Anhydrase_VIII_AF2187_Simple_Western_20463.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry: Carbonic Anhydrase X/CA10 Antibody [NBP2-31586] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells and moderate cytoplasmic nuclear in cells in molecular layer.](http://images.novusbio.com/fullsize/Carbonic-Anhydrase-X-CA10-Antibody-Immunohistochemistry-NBP2-31586-img0001.jpg "Immunohistochemistry: Carbonic Anhydrase X/CA10 Antibody [NBP2-31586] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells and moderate cytoplasmic nuclear in cells in molecular layer.")
![Immunohistochemistry: Carbonic Anhydrase X/CA10 Antibody [NBP2-31586] - Staining of pancreas.](http://images.novusbio.com/fullsize/Carbonic-Anhydrase-X-CA10-Antibody-Immunohistochemistry-NBP2-31586-img0002.jpg "Immunohistochemistry: Carbonic Anhydrase X/CA10 Antibody [NBP2-31586] - Staining of pancreas.")
![Immunohistochemistry: Carbonic Anhydrase X/CA10 Antibody [NBP2-31586] - Staining of liver cancer.](http://images.novusbio.com/fullsize/Carbonic-Anhydrase-X-CA10-Antibody-Immunohistochemistry-NBP2-31586-img0003.jpg "Immunohistochemistry: Carbonic Anhydrase X/CA10 Antibody [NBP2-31586] - Staining of liver cancer.")
![Immunohistochemistry: Carbonic Anhydrase X/CA10 Antibody [NBP2-31586] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells and moderate cytoplasmic nuclear in cells in molecular layer.](http://images.novusbio.com/fullsize/Carbonic-Anhydrase-X-CA10-Antibody-Immunohistochemistry-NBP2-31586-img0004.jpg "Immunohistochemistry: Carbonic Anhydrase X/CA10 Antibody [NBP2-31586] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells and moderate cytoplasmic nuclear in cells in molecular layer.")
![Immunohistochemistry: Carbonic Anhydrase X/CA10 Antibody [NBP2-31586] - Staining of liver cancer.](http://images.novusbio.com/fullsize/Carbonic-Anhydrase-X-CA10-Antibody-Immunohistochemistry-NBP2-31586-img0006.jpg "Immunohistochemistry: Carbonic Anhydrase X/CA10 Antibody [NBP2-31586] - Staining of liver cancer.")
![Immunohistochemistry: Carbonic Anhydrase X/CA10 Antibody [NBP2-31586] - Staining of pancreas.](http://images.novusbio.com/fullsize/Carbonic-Anhydrase-X-CA10-Antibody-Immunohistochemistry-NBP2-31586-img0005.jpg "Immunohistochemistry: Carbonic Anhydrase X/CA10 Antibody [NBP2-31586] - Staining of pancreas.")
![Immunohistochemistry-Paraffin: Carbonic Anhydrase X/CA10 Antibody [NBP2-31586] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.](http://images.novusbio.com/fullsize/Carbonic-Anhydrase-X-CA10-Antibody-Immunohistochemistry-Paraffin-NBP2-31586-img0007.jpg "Immunohistochemistry-Paraffin: Carbonic Anhydrase X/CA10 Antibody [NBP2-31586] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.")
![Immunohistochemistry-Paraffin: Carbonic Anhydrase X/CA10 Antibody [NBP2-31586] - Staining of human cerebral cortex shows weak cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/Carbonic-Anhydrase-X-CA10-Antibody-Immunohistochemistry-Paraffin-NBP2-31586-img0008.jpg "Immunohistochemistry-Paraffin: Carbonic Anhydrase X/CA10 Antibody [NBP2-31586] - Staining of human cerebral cortex shows weak cytoplasmic positivity in neurons.")
![Immunohistochemistry-Paraffin: Carbonic Anhydrase X/CA10 Antibody [NBP2-31586] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.](http://images.novusbio.com/fullsize/Carbonic-Anhydrase-X-CA10-Antibody-Immunohistochemistry-Paraffin-NBP2-31586-img0010.jpg "Immunohistochemistry-Paraffin: Carbonic Anhydrase X/CA10 Antibody [NBP2-31586] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.")
![Western Blot CXADR Antibody [Unconjugated]](https://images.novusbio.com/images2/CXADR_AF2654_Western_Blot_17043.jpg)
![Simple Western CXADR Antibody [Unconjugated]](https://images.novusbio.com/images2/CXADR_AF2654_Immunohistochemistry_17641.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")