Western Blot: SPINK1 Antibody (4D4) [H00006690-M01] - Detection against Immunogen (31.9 kDa). Antibody reactive against recombinant protein.
Immunohistochemistry-Paraffin: SPINK1 Antibody (4D4) [H00006690-M01] - Analysis of SPINK1 antibody (4D4) on mouse pancreas tissue. Antibody concentration 1 ug/ml. Image from verified customer review.
Western Blot: SPINK1 Antibody (4D4) [H00006690-M01] - SPINK1 monoclonal antibody (M01), clone 4D4. Analysis of SPINK1 expression in human pancreas.
Immunohistochemistry-Paraffin: SPINK1 Antibody (4D4) [H00006690-M01] - Analysis of monoclonal antibody to SPINK1 on formalin-fixed paraffin-embedded human pancreas. Antibody concentration 1 ug/ml.
Immunohistochemistry: SPINK1 Antibody (4D4) [H00006690-M01] - Representative images for immunohistochemical staining of SPINK1in 22RV1 xenograft tumors excised from orchiectomized mice treated with enzalutamide (20mg/kg ...read more
Immunohistochemistry: SPINK1 Antibody (4D4) [H00006690-M01] - Representative images showing H&E staining (x200 magnification) and immunostaining (x200 magnification) for AR, synaptophysin, and SPINK1 in tumor specimens ...read more
Immunohistochemistry: SPINK1 Antibody (4D4) [H00006690-M01] - IHC staining for SPINK1 and NPY of an adjacent section on the ST array. Nuclei are stained with DAPI (blue). Scale bar indicates 1mm. Image collected and ...read more
Immunohistochemistry: SPINK1 Antibody (4D4) [H00006690-M01] - ADT induced SPINK1 upregulation associates with NE-phenotype in mice and NEPC patients. Representative images of immunohistochemical staining for the same ...read more
Immunoprecipitation: SPINK1 Antibody (4D4) [H00006690-M01] - Analysis of SPINK1 transfected lysate using anti-SPINK1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SPINK1 MaxPab rabbit ...read more
ELISA: SPINK1 Antibody (4D4) [H00006690-M01] - Detection limit for recombinant GST tagged SPINK1 is 0.03 ng/ml as a capture antibody.
Immunohistochemistry: SPINK1 Antibody (4D4) [H00006690-M01] - ADT induced SPINK1 upregulation associates with NE-phenotype in mice & NEPC patients.a Box plots depicting relative expression of SPINK1, SYP, CHGA, TUBB3, & ...read more
Immunohistochemistry: SPINK1 Antibody (4D4) [H00006690-M01] - SPINK1 is negatively correlated with AR in PCa patients.a Heatmap depicting AR & SPINK1 expression in TCGA-PRAD cohort (n = 180). Shades of yellow & blue ...read more
Immunohistochemistry: SPINK1 Antibody (4D4) [H00006690-M01] - Spatial gene expression heterogeneity within the 1.2 cancer tissue sample. a Factor activity maps for selected factors corresponding to epithelial, stromal, ...read more
Immunohistochemistry: SPINK1 Antibody (4D4) [H00006690-M01] - ADT induced SPINK1 upregulation associates with NE-phenotype in mice & NEPC patients.a Box plots depicting relative expression of SPINK1, SYP, CHGA, TUBB3, & ...read more
Immunohistochemistry: SPINK1 Antibody (4D4) [H00006690-M01] - ADT induced SPINK1 upregulation associates with NE-phenotype in mice & NEPC patients.a Box plots depicting relative expression of SPINK1, SYP, CHGA, TUBB3, & ...read more
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
SPINK1 (AAH25790, 24 a.a. ~ 79 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC
Localization
Secreted
Specificity
SPINK1 - serine protease inhibitor, Kazal type 1
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SPINK1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Mouse reactivity reported in scientific literature (PMID: 32929152)
Packaging, Storage & Formulations
Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for SPINK1 Antibody (4D4)
pancreatic secretory trypsin inhibitor
PCTT
PCTTSpink3
PSTI
PSTISerine protease inhibitor Kazal-type 1
serine peptidase inhibitor, Kazal type 1
serine protease inhibitor, Kazal type 1
SPINK1
Spink3
TATI
TATITumor-associated trypsin inhibitor
Background
The protein encoded by this gene is a trypsin inhibitor, which is secreted from pancreatic acinar cells into pancreatic juice. It is thought to function in the prevention of trypsin-catalyzed premature activation of zymogens within the pancreas and the pancreatic duct. Mutations in this gene are associated with hereditary pancreatitis and tropical calcific pancreatitis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Khani F, Mosquera JM, Park K et al. 325 DIFFERENCES IN TMPRSS2-ERG GENE FUSION AND SPINK1 OVEREXPRESSION IN PROSTATE CANCER IN AFRICAN-AMERICAN AND CAUCASIAN MEN. The Journal of Urology 2012-01-01
Bhatia V, Yadav A, Tiwari R et al. Polycomb Group protein EZH2-mediated transcriptional repression of microRNA-338/-421 drives SPINK1-positive prostate cancer bioRxiv 2018-07-24 (IHC-P, Human)
IHC-P
Human
Francesca Khani, Juan Miguel Mosquera, Kyung Park et al. 325 DIFFERENCES IN TMPRSS2-ERG GENE FUSION AND SPINK1 OVEREXPRESSION IN PROSTATE CANCER IN AFRICAN-AMERICAN AND CAUCASIAN MEN J Urol. 2012-04-01 (IHC-P, Human)
IHC-P
Human
Manzar N, Khan U, Goel A et al. An integrative proteomics approach identifies tyrosine kinase KIT as a novel therapeutic target for SPINK1-positive prostate cancer bioRxiv 2023-07-26 (IHC, Human)
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: SPINK1 Antibody (4D4) [H00006690-M01] - Detection against Immunogen (31.9 kDa). Antibody reactive against recombinant protein.](http://images.novusbio.com/fullsize/SPINK1-Antibody-4D4-Western-Blot-H00006690-M01-img0010.jpg "Western Blot: SPINK1 Antibody (4D4) [H00006690-M01] - Detection against Immunogen (31.9 kDa). Antibody reactive against recombinant protein.")
![Immunohistochemistry-Paraffin: SPINK1 Antibody (4D4) [H00006690-M01] - Analysis of SPINK1 antibody (4D4) on mouse pancreas tissue. Antibody concentration 1 ug/ml. Image from verified customer review.](http://images.novusbio.com/fullsize/SPINK1-Antibody-4D4-Immunohistochemistry-Paraffin-H00006690-M01-img0016.jpg "Immunohistochemistry-Paraffin: SPINK1 Antibody (4D4) [H00006690-M01] - Analysis of SPINK1 antibody (4D4) on mouse pancreas tissue. Antibody concentration 1 ug/ml. Image from verified customer review.")
![Western Blot: SPINK1 Antibody (4D4) [H00006690-M01] - SPINK1 monoclonal antibody (M01), clone 4D4. Analysis of SPINK1 expression in human pancreas.](http://images.novusbio.com/fullsize/SPINK1-Antibody-4D4-Western-Blot-H00006690-M01-img0009.jpg "Western Blot: SPINK1 Antibody (4D4) [H00006690-M01] - SPINK1 monoclonal antibody (M01), clone 4D4. Analysis of SPINK1 expression in human pancreas.")
![Immunohistochemistry-Paraffin: SPINK1 Antibody (4D4) [H00006690-M01] - Analysis of monoclonal antibody to SPINK1 on formalin-fixed paraffin-embedded human pancreas. Antibody concentration 1 ug/ml.](http://images.novusbio.com/fullsize/SPINK1-Antibody-4D4-Immunohistochemistry-Paraffin-H00006690-M01-img0006.jpg "Immunohistochemistry-Paraffin: SPINK1 Antibody (4D4) [H00006690-M01] - Analysis of monoclonal antibody to SPINK1 on formalin-fixed paraffin-embedded human pancreas. Antibody concentration 1 ug/ml.")
![Immunohistochemistry: SPINK1 Antibody (4D4) [H00006690-M01] - Representative images for immunohistochemical staining of SPINK1in 22RV1 xenograft tumors excised from orchiectomized mice treated with enzalutamide (20mg/kg body weight) or vehicle control (n=5 each). Intact group represents non-castrated control mice (n=5). Scale bar represents 50um. Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41467-019-14184-0), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/SPINK1-Antibody-4D4-Immunohistochemistry-H00006690-M01-img0012.jpg "Immunohistochemistry: SPINK1 Antibody (4D4) [H00006690-M01] - Representative images for immunohistochemical staining of SPINK1in 22RV1 xenograft tumors excised from orchiectomized mice treated with enzalutamide (20mg/kg body weight) or vehicle control (n=5 each). Intact group represents non-castrated control mice (n=5). Scale bar represents 50um. Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41467-019-14184-0), licensed under a CC-BY license.")
![Immunohistochemistry: SPINK1 Antibody (4D4) [H00006690-M01] - Representative images showing H&E staining (x200 magnification) and immunostaining (x200 magnification) for AR, synaptophysin, and SPINK1 in tumor specimens obtained from NEPC patients', namely WCM12, WCM155 (an organoid), and WCM677. Scale bar represents 100um. Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41467-019-14184-0), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/SPINK1-Antibody-4D4-Immunohistochemistry-H00006690-M01-img0013.jpg "Immunohistochemistry: SPINK1 Antibody (4D4) [H00006690-M01] - Representative images showing H&E staining (x200 magnification) and immunostaining (x200 magnification) for AR, synaptophysin, and SPINK1 in tumor specimens obtained from NEPC patients', namely WCM12, WCM155 (an organoid), and WCM677. Scale bar represents 100um. Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41467-019-14184-0), licensed under a CC-BY license.")
![Immunohistochemistry: SPINK1 Antibody (4D4) [H00006690-M01] - IHC staining for SPINK1 and NPY of an adjacent section on the ST array. Nuclei are stained with DAPI (blue). Scale bar indicates 1mm. Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41467-018-04724-5), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/SPINK1-Antibody-4D4-Immunohistochemistry-H00006690-M01-img0014.jpg "Immunohistochemistry: SPINK1 Antibody (4D4) [H00006690-M01] - IHC staining for SPINK1 and NPY of an adjacent section on the ST array. Nuclei are stained with DAPI (blue). Scale bar indicates 1mm. Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41467-018-04724-5), licensed under a CC-BY license.")
![Immunohistochemistry: SPINK1 Antibody (4D4) [H00006690-M01] - ADT induced SPINK1 upregulation associates with NE-phenotype in mice and NEPC patients. Representative images of immunohistochemical staining for the same markers shown in a using VCaP xenograft tumors. Scale bar represents 100 um. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41467-019-14184-0), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/SPINK1-Antibody-4D4-Immunohistochemistry-H00006690-M01-img0015.jpg "Immunohistochemistry: SPINK1 Antibody (4D4) [H00006690-M01] - ADT induced SPINK1 upregulation associates with NE-phenotype in mice and NEPC patients. Representative images of immunohistochemical staining for the same markers shown in a using VCaP xenograft tumors. Scale bar represents 100 um. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41467-019-14184-0), licensed under a CC-BY license.")
![Immunoprecipitation: SPINK1 Antibody (4D4) [H00006690-M01] - Analysis of SPINK1 transfected lysate using anti-SPINK1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SPINK1 MaxPab rabbit polyclonal antibody.](http://images.novusbio.com/fullsize/SPINK1-Antibody-4D4-Immunoprecipitation-H00006690-M01-img0007.jpg "Immunoprecipitation: SPINK1 Antibody (4D4) [H00006690-M01] - Analysis of SPINK1 transfected lysate using anti-SPINK1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SPINK1 MaxPab rabbit polyclonal antibody.")
![ELISA: SPINK1 Antibody (4D4) [H00006690-M01] - Detection limit for recombinant GST tagged SPINK1 is 0.03 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/SPINK1-Antibody-4D4-ELISA-H00006690-M01-img0011.jpg "ELISA: SPINK1 Antibody (4D4) [H00006690-M01] - Detection limit for recombinant GST tagged SPINK1 is 0.03 ng/ml as a capture antibody.")
![Immunohistochemistry: SPINK1 Antibody (4D4) [H00006690-M01] - ADT induced SPINK1 upregulation associates with NE-phenotype in mice & NEPC patients.a Box plots depicting relative expression of SPINK1, SYP, CHGA, TUBB3, & VIM transcripts (read counts) in VCaP tumors implanted orthotopically in orchiectomized mice & subjected to vehicle (n = 4) or anti-androgens [enzalutamide (n = 4) or ARN-509 (n = 4)] treatment for 4 weeks (GSE95413). b Representative images of immunohistochemical staining for the same markers shown in a using VCaP xenograft tumors as described in a. Scale bar represents 100 μm. c Box plots depicting quantification of the immunohistochemical staining in VCaP xenografts for the markers shown in b. d Representative images for immunohistochemical staining of SPINK1, SYP, CHGA, & TUBB3 in 22RV1 xenograft tumors excised from orchiectomized mice treated with enzalutamide (20 mg/kg body weight) or vehicle control (n = 5 each). Intact group represents non-castrated control mice (n = 5). Scale bar represents 50 μm. e Box plots depicting quantification of the immunohistochemical staining in 22RV1 xenografts for the markers shown in d. f Representative images showing H&E staining (×200 magnification) & immunostaining (×200 magnification) for AR, synaptophysin, & SPINK1 in tumor specimens obtained from NEPC patients’, namely WCM12, WCM155 (an organoid), & WCM677. Scale bar represents 100 µm. Data are presented as box-and-whisker plots with median, where the box extends from 25th–75th percentile, & whiskers ranges from minimum & maximum values. For panels a, c, e one-way ANOVA, Dunnett’s multiple-comparisons test was applied. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31959826), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/h00006690-m01_mouse-monoclonal-spink1-antibody-4d4-31020241548221.jpg "Immunohistochemistry: SPINK1 Antibody (4D4) [H00006690-M01] - ADT induced SPINK1 upregulation associates with NE-phenotype in mice & NEPC patients.a Box plots depicting relative expression of SPINK1, SYP, CHGA, TUBB3, & VIM transcripts (read counts) in VCaP tumors implanted orthotopically in orchiectomized mice & subjected to vehicle (n = 4) or anti-androgens [enzalutamide (n = 4) or ARN-509 (n = 4)] treatment for 4 weeks (GSE95413). b Representative images of immunohistochemical staining for the same markers shown in a using VCaP xenograft tumors as described in a. Scale bar represents 100 μm. c Box plots depicting quantification of the immunohistochemical staining in VCaP xenografts for the markers shown in b. d Representative images for immunohistochemical staining of SPINK1, SYP, CHGA, & TUBB3 in 22RV1 xenograft tumors excised from orchiectomized mice treated with enzalutamide (20 mg/kg body weight) or vehicle control (n = 5 each). Intact group represents non-castrated control mice (n = 5). Scale bar represents 50 μm. e Box plots depicting quantification of the immunohistochemical staining in 22RV1 xenografts for the markers shown in d. f Representative images showing H&E staining (×200 magnification) & immunostaining (×200 magnification) for AR, synaptophysin, & SPINK1 in tumor specimens obtained from NEPC patients’, namely WCM12, WCM155 (an organoid), & WCM677. Scale bar represents 100 µm. Data are presented as box-and-whisker plots with median, where the box extends from 25th–75th percentile, & whiskers ranges from minimum & maximum values. For panels a, c, e one-way ANOVA, Dunnett’s multiple-comparisons test was applied. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31959826), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunohistochemistry: SPINK1 Antibody (4D4) [H00006690-M01] - SPINK1 is negatively correlated with AR in PCa patients.a Heatmap depicting AR & SPINK1 expression in TCGA-PRAD cohort (n = 180). Shades of yellow & blue represents expression values in log2 (RPM+1). b Representative micrographs depicting PCa tissue microarray (TMA) cores (n = 237), immunostained for SPINK1 & AR expression by immunohistochemistry (IHC). Top panel shows representative IHC for SPINK1 in SPINK1-negative (SPINK1−) & SPINK1-positive (SPINK1+) patients. Bottom panel represents IHC for AR expression in the tumor core from same patients. Scale bar represents 500 µm & 100 µm for the entire core & the inset images, respectively. c Bar plot showing percentage of IHC scoring for AR in the SPINK1+ & SPINK1− patients’ specimens. P-value for the Chi-Square test is indicated. d Contingency table for the AR & SPINK1 status. Patients showing high or medium expression of AR were grouped as AR-(Hi/Med), while patients with low or null AR expression were indicated as AR-(Low/Neg). P-value for Fisher’s exact test is indicated. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31959826), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/h00006690-m01_mouse-monoclonal-spink1-antibody-4d4-310202415485141.jpg "Immunohistochemistry: SPINK1 Antibody (4D4) [H00006690-M01] - SPINK1 is negatively correlated with AR in PCa patients.a Heatmap depicting AR & SPINK1 expression in TCGA-PRAD cohort (n = 180). Shades of yellow & blue represents expression values in log2 (RPM+1). b Representative micrographs depicting PCa tissue microarray (TMA) cores (n = 237), immunostained for SPINK1 & AR expression by immunohistochemistry (IHC). Top panel shows representative IHC for SPINK1 in SPINK1-negative (SPINK1−) & SPINK1-positive (SPINK1+) patients. Bottom panel represents IHC for AR expression in the tumor core from same patients. Scale bar represents 500 µm & 100 µm for the entire core & the inset images, respectively. c Bar plot showing percentage of IHC scoring for AR in the SPINK1+ & SPINK1− patients’ specimens. P-value for the Chi-Square test is indicated. d Contingency table for the AR & SPINK1 status. Patients showing high or medium expression of AR were grouped as AR-(Hi/Med), while patients with low or null AR expression were indicated as AR-(Low/Neg). P-value for Fisher’s exact test is indicated. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31959826), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunohistochemistry: SPINK1 Antibody (4D4) [H00006690-M01] - Spatial gene expression heterogeneity within the 1.2 cancer tissue sample. a Factor activity maps for selected factors corresponding to epithelial, stromal, cancerous, PIN, or inflamed regions. Remaining factors’ activity maps in Supplementary Figure 2 & Supplementary Data 1. b Annotated brightfield image of H&E-stained tissue section. c Heatmap of the 20 most variable genes between cancer, PIN & normal gland regions, using spot sets from Supplementary Fig. 4b. Centered rlog: difference of rlog (variance-stabilized transform of ST expression data) & gene-wise mean rlog. Arrows highlight genes of interest validated by immunohistochemistry (IHC). d First two principal components of spot sets from c separate cancer, PIN & normal regions. e Array dot plots for SPINK1 & NPY. Circle size in array dot plots indicates normalized ST counts. f IHC staining for SPINK1 & NPY of an adjacent section on the ST array. Nuclei are stained with DAPI (blue). Scale bar indicates 1 mm Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/29925878), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/h00006690-m01_mouse-monoclonal-spink1-antibody-4d4-310202415483612.jpg "Immunohistochemistry: SPINK1 Antibody (4D4) [H00006690-M01] - Spatial gene expression heterogeneity within the 1.2 cancer tissue sample. a Factor activity maps for selected factors corresponding to epithelial, stromal, cancerous, PIN, or inflamed regions. Remaining factors’ activity maps in Supplementary Figure 2 & Supplementary Data 1. b Annotated brightfield image of H&E-stained tissue section. c Heatmap of the 20 most variable genes between cancer, PIN & normal gland regions, using spot sets from Supplementary Fig. 4b. Centered rlog: difference of rlog (variance-stabilized transform of ST expression data) & gene-wise mean rlog. Arrows highlight genes of interest validated by immunohistochemistry (IHC). d First two principal components of spot sets from c separate cancer, PIN & normal regions. e Array dot plots for SPINK1 & NPY. Circle size in array dot plots indicates normalized ST counts. f IHC staining for SPINK1 & NPY of an adjacent section on the ST array. Nuclei are stained with DAPI (blue). Scale bar indicates 1 mm Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/29925878), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunohistochemistry: SPINK1 Antibody (4D4) [H00006690-M01] - ADT induced SPINK1 upregulation associates with NE-phenotype in mice & NEPC patients.a Box plots depicting relative expression of SPINK1, SYP, CHGA, TUBB3, & VIM transcripts (read counts) in VCaP tumors implanted orthotopically in orchiectomized mice & subjected to vehicle (n = 4) or anti-androgens [enzalutamide (n = 4) or ARN-509 (n = 4)] treatment for 4 weeks (GSE95413). b Representative images of immunohistochemical staining for the same markers shown in a using VCaP xenograft tumors as described in a. Scale bar represents 100 μm. c Box plots depicting quantification of the immunohistochemical staining in VCaP xenografts for the markers shown in b. d Representative images for immunohistochemical staining of SPINK1, SYP, CHGA, & TUBB3 in 22RV1 xenograft tumors excised from orchiectomized mice treated with enzalutamide (20 mg/kg body weight) or vehicle control (n = 5 each). Intact group represents non-castrated control mice (n = 5). Scale bar represents 50 μm. e Box plots depicting quantification of the immunohistochemical staining in 22RV1 xenografts for the markers shown in d. f Representative images showing H&E staining (×200 magnification) & immunostaining (×200 magnification) for AR, synaptophysin, & SPINK1 in tumor specimens obtained from NEPC patients’, namely WCM12, WCM155 (an organoid), & WCM677. Scale bar represents 100 µm. Data are presented as box-and-whisker plots with median, where the box extends from 25th–75th percentile, & whiskers ranges from minimum & maximum values. For panels a, c, e one-way ANOVA, Dunnett’s multiple-comparisons test was applied. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31959826), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/h00006690-m01_mouse-monoclonal-spink1-antibody-4d4-31020241548366.jpg "Immunohistochemistry: SPINK1 Antibody (4D4) [H00006690-M01] - ADT induced SPINK1 upregulation associates with NE-phenotype in mice & NEPC patients.a Box plots depicting relative expression of SPINK1, SYP, CHGA, TUBB3, & VIM transcripts (read counts) in VCaP tumors implanted orthotopically in orchiectomized mice & subjected to vehicle (n = 4) or anti-androgens [enzalutamide (n = 4) or ARN-509 (n = 4)] treatment for 4 weeks (GSE95413). b Representative images of immunohistochemical staining for the same markers shown in a using VCaP xenograft tumors as described in a. Scale bar represents 100 μm. c Box plots depicting quantification of the immunohistochemical staining in VCaP xenografts for the markers shown in b. d Representative images for immunohistochemical staining of SPINK1, SYP, CHGA, & TUBB3 in 22RV1 xenograft tumors excised from orchiectomized mice treated with enzalutamide (20 mg/kg body weight) or vehicle control (n = 5 each). Intact group represents non-castrated control mice (n = 5). Scale bar represents 50 μm. e Box plots depicting quantification of the immunohistochemical staining in 22RV1 xenografts for the markers shown in d. f Representative images showing H&E staining (×200 magnification) & immunostaining (×200 magnification) for AR, synaptophysin, & SPINK1 in tumor specimens obtained from NEPC patients’, namely WCM12, WCM155 (an organoid), & WCM677. Scale bar represents 100 µm. Data are presented as box-and-whisker plots with median, where the box extends from 25th–75th percentile, & whiskers ranges from minimum & maximum values. For panels a, c, e one-way ANOVA, Dunnett’s multiple-comparisons test was applied. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31959826), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunohistochemistry: SPINK1 Antibody (4D4) [H00006690-M01] - ADT induced SPINK1 upregulation associates with NE-phenotype in mice & NEPC patients.a Box plots depicting relative expression of SPINK1, SYP, CHGA, TUBB3, & VIM transcripts (read counts) in VCaP tumors implanted orthotopically in orchiectomized mice & subjected to vehicle (n = 4) or anti-androgens [enzalutamide (n = 4) or ARN-509 (n = 4)] treatment for 4 weeks (GSE95413). b Representative images of immunohistochemical staining for the same markers shown in a using VCaP xenograft tumors as described in a. Scale bar represents 100 μm. c Box plots depicting quantification of the immunohistochemical staining in VCaP xenografts for the markers shown in b. d Representative images for immunohistochemical staining of SPINK1, SYP, CHGA, & TUBB3 in 22RV1 xenograft tumors excised from orchiectomized mice treated with enzalutamide (20 mg/kg body weight) or vehicle control (n = 5 each). Intact group represents non-castrated control mice (n = 5). Scale bar represents 50 μm. e Box plots depicting quantification of the immunohistochemical staining in 22RV1 xenografts for the markers shown in d. f Representative images showing H&E staining (×200 magnification) & immunostaining (×200 magnification) for AR, synaptophysin, & SPINK1 in tumor specimens obtained from NEPC patients’, namely WCM12, WCM155 (an organoid), & WCM677. Scale bar represents 100 µm. Data are presented as box-and-whisker plots with median, where the box extends from 25th–75th percentile, & whiskers ranges from minimum & maximum values. For panels a, c, e one-way ANOVA, Dunnett’s multiple-comparisons test was applied. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31959826), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/h00006690-m01_mouse-monoclonal-spink1-antibody-4d4-310202415483636.jpg "Immunohistochemistry: SPINK1 Antibody (4D4) [H00006690-M01] - ADT induced SPINK1 upregulation associates with NE-phenotype in mice & NEPC patients.a Box plots depicting relative expression of SPINK1, SYP, CHGA, TUBB3, & VIM transcripts (read counts) in VCaP tumors implanted orthotopically in orchiectomized mice & subjected to vehicle (n = 4) or anti-androgens [enzalutamide (n = 4) or ARN-509 (n = 4)] treatment for 4 weeks (GSE95413). b Representative images of immunohistochemical staining for the same markers shown in a using VCaP xenograft tumors as described in a. Scale bar represents 100 μm. c Box plots depicting quantification of the immunohistochemical staining in VCaP xenografts for the markers shown in b. d Representative images for immunohistochemical staining of SPINK1, SYP, CHGA, & TUBB3 in 22RV1 xenograft tumors excised from orchiectomized mice treated with enzalutamide (20 mg/kg body weight) or vehicle control (n = 5 each). Intact group represents non-castrated control mice (n = 5). Scale bar represents 50 μm. e Box plots depicting quantification of the immunohistochemical staining in 22RV1 xenografts for the markers shown in d. f Representative images showing H&E staining (×200 magnification) & immunostaining (×200 magnification) for AR, synaptophysin, & SPINK1 in tumor specimens obtained from NEPC patients’, namely WCM12, WCM155 (an organoid), & WCM677. Scale bar represents 100 µm. Data are presented as box-and-whisker plots with median, where the box extends from 25th–75th percentile, & whiskers ranges from minimum & maximum values. For panels a, c, e one-way ANOVA, Dunnett’s multiple-comparisons test was applied. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31959826), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunohistochemistry Trypsin 1/PRSS1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Trypsin_1_AF3848_Immunohistochemistry_17574.jpg)
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_6973.jpg)
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_9671.jpg)
![Immunoprecipitation CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images/mab25031_human-cftr-c-terminus-mab-clone-24-1-41202412513815.jpg)
![Immunoprecipitation Trypsin 2/PRSS2 Antibody (410322) [Unconjugated]](https://images.novusbio.com/images/antibody/mab3586_human-trypsin-2-prss2-mab-clone-410322-immunoprecipitation-24920201666.jpg)
![Western Blot Trypsin 2/PRSS2 Antibody (410322) [Unconjugated]](https://images.novusbio.com/images/antibody/mab3586_human-trypsin-2-prss2-mab-clone-410322-western-blot-2492020154158.jpg)
![Western Blot Trypsin 2/PRSS2 Antibody (410322) [Unconjugated]](https://images.novusbio.com/images/antibody/mab3586_human-trypsin-2-prss2-mab-clone-410322-western-blot-2492020154539.jpg)
![Western Blot BMP-1/PCP Antibody [Unconjugated]](https://images.novusbio.com/images2/BMP1_AF1927_Western_Blot_21018.jpg)
![Western Blot BMP-1/PCP Antibody [Unconjugated]](https://images.novusbio.com/images2/BMP1_AF1927_Western_Blot_21019.jpg)
![SDS-PAGE EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236-EG_234.jpg)
![Bioactivity EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236EG_1570.jpg)
![Cell Culture EGF [Unconjugated]](https://images.novusbio.com/images/236-eg_recombinant-human-egf-protein-cf-bioactivity-25202394053.jpg)
![Bioactivity BMP-2 [Unconjugated]](https://images.novusbio.com/images/protein/355-bm_recombinant-human-mouse-rat-bmp-2-protein-bioactivity-181120209742.jpg)
![Immunohistochemistry CEACAM7 Antibody [Unconjugated]](https://images.novusbio.com/images2/CEACAM7_AF4478_Immunohistochemistry_20616.jpg)
![Western Blot CEACAM7 Antibody [Unconjugated]](https://images.novusbio.com/images2/CEACAM-7_AF4478_Western_Blot_5475.jpg)
![N/A C-Reactive Protein/CRP [Biotin]](https://images.novusbio.com/images2/DATA_CReactive_Protein_DY1707_ELISA_1701.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
