![Western Blot: Carbonic Anhydrase I/CA1 Antibody [H00000759-D01P] - Analysis of CA1 expression in mouse brain.](http://images.novusbio.com/fullsize/Carbonic-Anhydrase-I-CA1-Antibody-Western-Blot-H00000759-D01P-img0005.jpg "Western Blot: Carbonic Anhydrase I/CA1 Antibody [H00000759-D01P] - Analysis of CA1 expression in mouse brain.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody reactive against mammalian transfected lysate. |
| Immunogen | CA1 (NP_001729.1, 1 a.a. - 261 a.a.) full-length human protein. MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF |
| Specificity | CA1 - carbonic anhydrase I, |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CA1 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
| Publication using H00000759-D01P | Applications | Species |
|---|---|---|
| Jokerst JV, Chen Z, Xu L et al. A Magnetic Bead-Based Sensor for the Quantification of Multiple Prostate Cancer Biomarkers. PLoS One 2015-01-01 [PMID: 26421725] (Human) | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for Carbonic Anhydrase I/CA1 Antibody (H00000759-D01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CA1 |
| Entrez |
|
| Uniprot |
|
![Western Blot: Carbonic Anhydrase I/CA1 Antibody [H00000759-D01P] - Analysis of CA1 expression in human colon.](http://images.novusbio.com/fullsize/Carbonic-Anhydrase-I-CA1-Antibody-Western-Blot-H00000759-D01P-img0003.jpg "Western Blot: Carbonic Anhydrase I/CA1 Antibody [H00000759-D01P] - Analysis of CA1 expression in human colon.")
![Western Blot: Carbonic Anhydrase I/CA1 Antibody [H00000759-D01P] - Analysis of CA1 expression in human placenta.](http://images.novusbio.com/fullsize/Carbonic-Anhydrase-I-CA1-Antibody-Western-Blot-H00000759-D01P-img0004.jpg "Western Blot: Carbonic Anhydrase I/CA1 Antibody [H00000759-D01P] - Analysis of CA1 expression in human placenta.")
![Western Blot: Carbonic Anhydrase I/CA1 Antibody [H00000759-D01P] - Analysis of CA1 expression in transfected 293T cell line by CA1 polyclonal antibody.Lane 1: CA1 transfected lysate(28.90 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/Carbonic-Anhydrase-I-CA1-Antibody-Western-Blot-H00000759-D01P-img0006.jpg "Western Blot: Carbonic Anhydrase I/CA1 Antibody [H00000759-D01P] - Analysis of CA1 expression in transfected 293T cell line by CA1 polyclonal antibody.Lane 1: CA1 transfected lysate(28.90 KDa).Lane 2: Non-transfected lysate.")
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_587.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_588.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/BDNF_DBD00_ELISA_36.jpg)
![Western Blot Carbonic Anhydrase IV/CA4 Antibody (310413) [Unconjugated]](https://images.novusbio.com/images2/Carbonic_Anhydrase_IV_MAB2186_Western_Blot_11051.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_6532.jpg)
![Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase3_AF835_Immunohistochemistry_22976.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_9340.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")