Home » Cannabinoid R1/CB1/CNR1 » Cannabinoid R1/CB1/CNR1 Proteins » Recombinant Human Cannabinoid R1/CB1/CNR1 GST (N-Term) Protein
Novus Biologicals products are now on bio-techne.com

Recombinant Human Cannabinoid R1/CB1/CNR1 GST (N-Term) Protein

 Submit a Review

Images

 
(
Enlarge)
SDS-Page: Recombinant Human Cannabinoid R1/CB1/CNR1 Protein [H00001268-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
SDS-Page: Recombinant Human Cannabinoid R1/CB1/CNR1 Protein [H00001268-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, PAGE, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Recombinant Human Cannabinoid R1/CB1/CNR1 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-472 of Human CNR1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVFHRKDSRNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDETYLMFWIGVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQPLDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
CNR1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
79.3 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Cannabinoid R1/CB1/CNR1 GST (N-Term) Protein

  • CANN6
  • CANN6CB1R
  • Cannabinoid R1
  • cannabinoid receptor 1 (brain)
  • CannabinoidR1
  • CB1
  • CB1A
  • CB1K5
  • CB1R
  • CB-R
  • CB-RCB1cannabinoid receptor 1
  • central cannabinoid receptor
  • CNR
  • CNR1
  • SKR6R

Background

This gene encodes a protein that is one of two cannabinoid receptors. The cannabinoids, principally delta-9-tetrahydrocannabinol and synthetic analogs, are psychoactive ingredients of marijuana. The cannabinoid receptors are members of the family of guanine-nucleotide-binding protein (G-protein) coupled receptors which inhibit adenylate cyclase activity in a dose-dependent, stereoselective and pertussis toxin-sensitive manner. The two receptors have been found to be involved in the cannabinoid-induced CNS effects (including alterations in mood and cognition) experienced by users of marijuana. Two transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Cannabinoid
R2/CB2/CNR2 Antibody
H00001269-M01
Western Blot Cannabinoid R2/CB2/CNR2 Antibody (3C7)
ELISA Cannabinoid R2/CB2/CNR2 Antibody (3C7)
Immunocytochemistry/ Immunofluorescence Cannabinoid R2/CB2/CNR2 Antibody (3C7)
(4 Publications)
Species: Pm, Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
FAAH Antibody (4H8)
H00002166-M07
Western Blot FAAH Antibody (4H8)
ELISA FAAH Antibody (4H8)
Western Blot FAAH Antibody (4H8)
(4 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, WB
FA2H Antibody
(OTI2E3)
NBP2-45564
Western Blot FA2H Antibody (OTI2E3)
Immunofluorescence FA2H Antibody (OTI2E3)
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Vanilloid R1/TRPV1
Antibody - BSA Free
NBP1-71774
Immunohistochemistry-Paraffin Vanilloid R1/TRPV1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Vanilloid R1/TRPV1 Antibody - BSA Free
Immunohistochemistry Vanilloid R1/TRPV1 Antibody - BSA Free
(1 Review)
(12 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
WASP Antibody
NB300-996
Immunohistochemistry-Paraffin WASP Antibody
Immunocytochemistry/ Immunofluorescence WASP Antibody
Immunocytochemistry/ Immunofluorescence WASP Antibody
(1 Publication)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
gamma-Synuclein
Antibody
NBP1-89996
Western Blot gamma-Synuclein Antibody
Immunohistochemistry-Paraffin gamma-Synuclein Antibody
Immunohistochemistry gamma-Synuclein Antibody
Species: Hu
Applications: IHC, IHC-P, WB
Secretin R Antibody
NBP1-86125
Immunohistochemistry-Paraffin Secretin R Antibody
Immunohistochemistry-Paraffin Secretin R Antibody
Immunohistochemistry-Paraffin Secretin R Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
PCDHA6 Antibody
(1A3)
H00056142-M05
ELISA PCDHA6 Antibody (1A3)
Western Blot PCDHA6 Antibody (1A3)
Species: Hu
Applications: ELISA, WB
Monoglyceride
Lipase Antibody (OTI2
NBP2-00735
Western Blot Monoglyceride Lipase Antibody (OTI2B11)
Immunocytochemistry/ Immunofluorescence Monoglyceride Lipase Antibody (OTI2B11)
Flow Cytometry Monoglyceride Lipase Antibody (OTI2B11)
(1 Publication)
Species: Hu, Pm
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Ceruloplasmin
Antibody (6C3K9)
NBP3-15868
Immunohistochemistry-Paraffin Ceruloplasmin Antibody (6C3K9)
Immunohistochemistry-Paraffin Ceruloplasmin Antibody (6C3K9)
Immunohistochemistry Ceruloplasmin Antibody (6C3K9)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(817 Publications)
Species: Hu
Applications: BA
Carbonic Anhydrase
I/CA1 Antibody
NBP1-88191
Western Blot Carbonic Anhydrase I/CA1 Antibody
Immunohistochemistry-Paraffin Carbonic Anhydrase I/CA1 Antibody
Immunohistochemistry-Paraffin Carbonic Anhydrase I/CA1 Antibody
(3 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Cholecystokinin
Antibody
NBP3-18225
Immunocytochemistry/ Immunofluorescence Cholecystokinin Antibody
Immunohistochemistry-Paraffin Cholecystokinin Antibody
Western Blot Cholecystokinin Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-P, WB
POMC Antibody
NB100-1533
Flow Cytometry POMC Antibody
Immunohistochemistry POMC Antibody
Immunohistochemistry POMC Antibody
(10 Publications)
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Adiponectin/Acrp30
[HRP]
DRP300
N/A Adiponectin/Acrp30 [HRP]
N/A Adiponectin/Acrp30 [HRP]
N/A Adiponectin/Acrp30 [HRP]
(186 Publications)
Species: Hu
Applications: ELISA
Leptin/OB [HRP]
DLP00
N/A Leptin/OB [HRP]
N/A Leptin/OB [HRP]
(155 Publications)
Species: Hu
Applications: ELISA
Recombinant Human
Cannabinoid R1/CB1/CN ...
H00001268-P01
Recombinant Human Cannabinoid R1/CB1/CNR1 GST (N-Term) Protein
Species: Hu
Applications: WB, ELISA, MA, PAGE, AP

Publications for Cannabinoid R1/CB1/CNR1 Recombinant Protein (H00001268-P01) (0)

There are no publications for Cannabinoid R1/CB1/CNR1 Recombinant Protein (H00001268-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cannabinoid R1/CB1/CNR1 Recombinant Protein (H00001268-P01) (0)

There are no reviews for Cannabinoid R1/CB1/CNR1 Recombinant Protein (H00001268-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cannabinoid R1/CB1/CNR1 Recombinant Protein (H00001268-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Cannabinoid R1/CB1/CNR1 Products

Research Areas for Cannabinoid R1/CB1/CNR1 Recombinant Protein (H00001268-P01)

Find related products by research area.

Blogs on Cannabinoid R1/CB1/CNR1

There are no specific blogs for Cannabinoid R1/CB1/CNR1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Cannabinoid R1/CB1/CNR1 GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol CNR1